BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001756-TA|BGIBMGA001756-PA|undefined (202 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0033 + 202703-202705,203397-203458,203566-203665,203875-20... 31 0.85 01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104,238... 31 0.85 03_02_0348 + 7709894-7709926,7710516-7710604,7711202-7711277,771... 29 2.0 11_06_0349 + 22565405-22566279,22567774-22569772,22570360-225704... 29 2.6 08_01_0483 - 4243963-4244019,4244243-4245797,4246335-4246651 29 2.6 03_06_0114 + 31751471-31751785,31751919-31752056,31752183-317522... 29 3.4 09_04_0468 + 17848144-17848174,17849032-17849378,17849505-17849921 28 6.0 07_03_1647 + 28370226-28370369,28370452-28370611,28370704-283708... 28 6.0 05_04_0111 - 18079051-18079970,18080384-18080462 28 6.0 05_01_0008 + 60498-60552,60644-60864,60956-61013,61271-61443,615... 28 6.0 03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339,324... 28 6.0 12_02_1035 - 25570009-25571241,25571940-25573709,25573797-255751... 27 7.9 10_08_0304 - 16640937-16642877 27 7.9 08_02_0008 + 11212351-11214506,11214548-11214584 27 7.9 03_06_0656 - 35330109-35331011,35331154-35331360,35331455-353316... 27 7.9 03_02_0971 - 12807981-12808094,12808949-12809053,12809236-128092... 27 7.9 >02_01_0033 + 202703-202705,203397-203458,203566-203665,203875-203916, 204264-204305,204437-204589,206559-207221 Length = 354 Score = 30.7 bits (66), Expect = 0.85 Identities = 21/86 (24%), Positives = 46/86 (53%), Gaps = 5/86 (5%) Query: 86 KLLEKVTVKCVAQTHAVKKLITTPDRALDAEMLTRKQNIMEALTNYRDKETSLRHFEMIL 145 KLL + C Q +++L +++L + +++ +M+ + R+KE +L M+L Sbjct: 23 KLLGEGLGSCSVQE--LQELEVQLEKSLCSIRQKKQKMLMDQILELREKEMNLLKENMVL 80 Query: 146 QEKQYEHNLLRAEWDKSLGELRDMKA 171 ++ + L + W S+GEL++ +A Sbjct: 81 RD---QCKALSSPWSTSVGELKNKQA 103 >01_01_0292 - 2387653-2387711,2388061-2388684,2388814-2389104, 2389338-2389390,2390496-2390968,2391090-2391432, 2391793-2391911,2392081-2392512,2392657-2392747, 2392833-2392942,2393681-2393875,2394581-2394622, 2395144-2395268,2395856-2395926,2396047-2396147 Length = 1042 Score = 30.7 bits (66), Expect = 0.85 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Query: 105 LITTPDRALDAEMLT--RKQNIMEALTNYRDKETSLRHFEMILQEKQYEHNLLRAEWDKS 162 L++ PD L E L +KQ +++ T R + R E L+EKQ E L + Sbjct: 377 LVSVPDETLTPEQLKEKKKQILLKTTTEGRMRAKQRRAEEEALREKQEEERRLENP-ELY 435 Query: 163 LGELRDMKAAVSD 175 L ELR + +SD Sbjct: 436 LEELRARYSELSD 448 >03_02_0348 + 7709894-7709926,7710516-7710604,7711202-7711277, 7712019-7712214,7712449-7712832,7712884-7714804, 7714906-7714966,7715952-7716371 Length = 1059 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/39 (33%), Positives = 21/39 (53%) Query: 104 KLITTPDRALDAEMLTRKQNIMEALTNYRDKETSLRHFE 142 K++ + L AE+ +QN E +T YRD E + +E Sbjct: 864 KVLQSKIEVLTAELDDERQNHQEDITRYRDLEEKIERYE 902 >11_06_0349 + 22565405-22566279,22567774-22569772,22570360-22570478, 22570835-22571117 Length = 1091 Score = 29.1 bits (62), Expect = 2.6 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Query: 97 AQTHAVKKLITTPDRALDAEMLTRKQNIMEALTNYRDKETSLRHFEMILQEKQYEHNLLR 156 A + AVK L T +L A+ T + + + D+ S++ F L+ + +H+ R Sbjct: 7 ASSEAVKSL-TGKLGSLLAQEYTLIAGVRDDIQYINDELASMQAFLSKLKRRDVDHDEQR 65 Query: 157 AEWDKSLGELR-DMKAAVSD 175 +W K + E+ D+K V D Sbjct: 66 QDWMKQVREVAYDIKDCVDD 85 >08_01_0483 - 4243963-4244019,4244243-4245797,4246335-4246651 Length = 642 Score = 29.1 bits (62), Expect = 2.6 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 6/81 (7%) Query: 87 LLEKVTVKCVAQT--HAVKKLITTPD---RALDAEMLTRKQNIMEALTNYRDKETSLRHF 141 L + V +K VA+ + +K TT D A D ++ +++ + D+E+ ++++ Sbjct: 85 LTKPVELKIVAKEFENGLKYSGTTDDLETEASDRNIIDNRRHSVSEFMEKLDQESEIKYY 144 Query: 142 EMILQEKQYEH-NLLRAEWDK 161 E L+E E+ N ++ EW K Sbjct: 145 ENKLKEINEEYNNSMKCEWPK 165 >03_06_0114 + 31751471-31751785,31751919-31752056,31752183-31752291, 31756033-31756598 Length = 375 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 115 AEMLTRKQNIMEALTNYRDKETSLRHFEMILQEKQYEHNLLRAEWDKSLGELRDM 169 AE +R + +++L + T E +KQ +H LLR ++ SLG+LR + Sbjct: 173 AEFFSRVETQLDSLAESNCEGTGSSEEEQDPSDKQLKHQLLR-KYGGSLGDLRQV 226 >09_04_0468 + 17848144-17848174,17849032-17849378,17849505-17849921 Length = 264 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/27 (37%), Positives = 19/27 (70%) Query: 151 EHNLLRAEWDKSLGELRDMKAAVSDDE 177 +H+ LR + D L E++++KA + D+E Sbjct: 112 DHDALRRDKDALLAEIKELKAKLGDEE 138 >07_03_1647 + 28370226-28370369,28370452-28370611,28370704-28370831, 28372512-28372628,28372729-28372782,28372985-28373075, 28373517-28373688,28374452-28374573,28374726-28374817, 28375331-28375373,28375596-28375656,28376367-28376515, 28376659-28376729,28376805-28376975,28377056-28377124, 28377427-28377528,28377629-28377697,28378060-28378138, 28378238-28378337,28378438-28378513,28378715-28378894, 28379430-28379552,28379634-28379717,28380068-28380252, 28380339-28380477,28380585-28380644,28380926-28381030, 28381332-28381445 Length = 1019 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/35 (42%), Positives = 22/35 (62%) Query: 2 SAFKTLKEVSQNFEQELKQLSNVLFSAKIGETFED 36 S K+LK+V+ E E + L +V+ +IG TFED Sbjct: 684 STKKSLKDVTTENEFEKRLLGDVIPPDEIGVTFED 718 >05_04_0111 - 18079051-18079970,18080384-18080462 Length = 332 Score = 27.9 bits (59), Expect = 6.0 Identities = 12/51 (23%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Query: 112 ALDAEMLTRKQNIMEALTNYRDKETSLRHFEMILQEKQYEH-NLLRAEWDK 161 A D ++ ++++ + D+E+ ++++E L+E E+ N ++ EW K Sbjct: 156 ASDRNIIDKRRHSISEFMEKLDQESEIKYYENKLKEINEEYNNSMKCEWPK 206 >05_01_0008 + 60498-60552,60644-60864,60956-61013,61271-61443, 61528-61711,61823-61993,62483-62514,62596-62638, 62768-62835,63561-63605,63695-64162 Length = 505 Score = 27.9 bits (59), Expect = 6.0 Identities = 17/69 (24%), Positives = 33/69 (47%), Gaps = 1/69 (1%) Query: 65 QITEQVKTEEIIKEYGDVAAIKLLEKVTVKCVAQTHAVKKLITTPDRALDAEMLTRKQNI 124 QI ++ E +A+ + K + +A KK++ T +ALD++ K ++ Sbjct: 194 QIKSKIDEETAEAVKASASAVSAIAKTNQELLASKDEEKKILVTLTQALDSQAKELK-SL 252 Query: 125 MEALTNYRD 133 E+L + RD Sbjct: 253 CESLNHSRD 261 >03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339, 3242494-3242836,3244138-3248540,3248928-3249107, 3249108-3250892,3251055-3252173 Length = 2727 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/39 (28%), Positives = 23/39 (58%) Query: 129 TNYRDKETSLRHFEMILQEKQYEHNLLRAEWDKSLGELR 167 +N+ KE +L E + + Q + NL++ + ++GEL+ Sbjct: 645 SNHMHKEAALHALENLHSQSQEDFNLVKLNLENTVGELK 683 >12_02_1035 - 25570009-25571241,25571940-25573709,25573797-25575118, 25575208-25575555,25576540-25576633 Length = 1588 Score = 27.5 bits (58), Expect = 7.9 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 12/109 (11%) Query: 62 LTPQITEQVKTEEIIKEYGDVAAIKLLEKVTVKCVAQTHAVKKLITTPDRALDAEMLTRK 121 LT I ++ + +YG + +KL V V+ + H +K L+ T DA+ + + Sbjct: 729 LTEGIGSVMEELHLDDKYGSLDLMKL--DVIVQLIL--HEIKCLLNTIS---DAQDVKQN 781 Query: 122 QNIMEALTNYRDKETSLRHFEMILQEKQYEHNLLRAEWDKSLGELRDMK 170 Q + ++L T L HF + + + E ++LR EW EL ++ Sbjct: 782 QILEKSLV-----VTLLEHFGREVADLRSERSVLRQEWQAKSEELLQLQ 825 >10_08_0304 - 16640937-16642877 Length = 646 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Query: 164 GELRDMKAAVSDDEEMDTNSAYYVLVLLDLYKRE 197 GELR+M+A V+D + + + YVL L + ++ Sbjct: 540 GELREMRARVADRRQYELSGRAYVLAGLSSHAQQ 573 >08_02_0008 + 11212351-11214506,11214548-11214584 Length = 730 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 4/62 (6%) Query: 104 KLITTPD---RALDAEMLTRKQNIMEALTNYRDKETSLRHFEMILQEKQYEH-NLLRAEW 159 K TT D A D ++ +++ + D+E+ ++++E L+E E+ N ++ EW Sbjct: 280 KTRTTDDLETEASDRNIIDNRRHSVSEFMEKLDQESEIKYYENKLKEINEEYNNSMKCEW 339 Query: 160 DK 161 K Sbjct: 340 PK 341 >03_06_0656 - 35330109-35331011,35331154-35331360,35331455-35331632, 35331726-35332221,35332889-35333033 Length = 642 Score = 27.5 bits (58), Expect = 7.9 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 7/93 (7%) Query: 57 AKPVSLTPQITEQVKTEEIIKEYGDVAAIKLLEKVTVKCVAQTHAVKKLITTPDRALDAE 116 AKPVS + T V + K+ GD EK V+ A +KL D + + Sbjct: 203 AKPVSGPEESTGDVAQDNSKKDGGDP------EKKKVRNTLSGSAKRKLKKKHDSKVSGK 256 Query: 117 MLTRKQNIMEALTNYRDKETSLRHFEMILQEKQ 149 ++ E L K+ +L +E +L+EK+ Sbjct: 257 T-EKEAEKAEVLKEEERKDMTLEEYEKVLEEKR 288 >03_02_0971 - 12807981-12808094,12808949-12809053,12809236-12809295, 12809399-12809537,12809648-12809832,12809926-12810009, 12810093-12810215,12810617-12810796,12811017-12811092, 12811178-12811277,12811355-12811430,12812155-12812244, 12812342-12812449,12813583-12813651,12813751-12813921, 12814002-12814072,12814263-12814360,12814659-12814719, 12814935-12814971,12815217-12815308,12815428-12815549, 12816281-12816414 Length = 764 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/32 (40%), Positives = 22/32 (68%) Query: 5 KTLKEVSQNFEQELKQLSNVLFSAKIGETFED 36 K+LK+++ E E + L++V+ +IG TFED Sbjct: 432 KSLKDIATENEFEKRLLADVIPPDEIGVTFED 463 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.129 0.351 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,388,220 Number of Sequences: 37544 Number of extensions: 139588 Number of successful extensions: 474 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 464 Number of HSP's gapped (non-prelim): 20 length of query: 202 length of database: 14,793,348 effective HSP length: 79 effective length of query: 123 effective length of database: 11,827,372 effective search space: 1454766756 effective search space used: 1454766756 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -