BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001754-TA|BGIBMGA001754-PA|IPR007122|Gelsolin, IPR007123|Gelsolin region (527 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 1.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.6 bits (51), Expect = 1.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Query: 315 VDIVLCSSVFVSKVKPTFESLNNGDCFILDVDHQ 348 V++V C + KV P + NNG C + H+ Sbjct: 136 VEMVSCKDAALRKVVPLKKLCNNGTCEDIGNSHR 169 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,673 Number of Sequences: 317 Number of extensions: 5928 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 527 length of database: 114,650 effective HSP length: 60 effective length of query: 467 effective length of database: 95,630 effective search space: 44659210 effective search space used: 44659210 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -