BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001751-TA|BGIBMGA001751-PA|IPR002048|Calcium-binding EF-hand (217 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0202 + 1605703-1606402,1606681-1606824,1606911-1607063,160... 32 0.41 12_01_0217 + 1647319-1648327,1648462-1648577,1648650-1648817,164... 31 0.55 11_06_0212 - 21319441-21319498,21319737-21319867,21319944-213200... 31 0.95 11_01_0449 - 3473662-3475049,3476026-3476128,3476215-3476439,347... 29 2.2 04_04_0934 + 29504806-29505532,29506059-29506202,29506291-295064... 29 2.2 07_03_1756 - 29239137-29239325,29239741-29240259,29240693-292408... 29 3.8 03_06_0239 - 32578231-32578353,32578431-32578655,32579081-325792... 29 3.8 02_05_1339 + 35793795-35794922,35795009-35795233,35795314-35795460 29 3.8 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 28 5.1 04_04_0349 + 24588184-24588315,24588481-24588543,24588674-245887... 28 5.1 04_01_0490 - 6440176-6440448,6440785-6441074,6441156-6441304,644... 28 5.1 11_06_0022 + 19321886-19321918,19323059-19323131,19323587-193236... 28 6.7 09_04_0557 + 18503380-18503793 28 6.7 04_04_0786 - 28052981-28053040,28053123-28053222,28053447-280535... 28 6.7 04_04_0419 + 25086456-25086768,25087302-25087369,25087458-250876... 28 6.7 12_01_0450 - 3552701-3552865,3552971-3553195,3553306-3553473,355... 27 8.9 11_04_0105 - 13505786-13505800,13505940-13506043,13506421-135066... 27 8.9 11_01_0203 - 1610086-1610192,1610620-1610669,1610888-1611348 27 8.9 10_08_0781 + 20509033-20509714,20510048-20510191,20510604-205107... 27 8.9 09_04_0397 + 17273013-17273570 27 8.9 07_01_0437 - 3322132-3322251,3322345-3322569,3322953-3323120,332... 27 8.9 03_06_0235 + 32539025-32539886,32540330-32540473,32540595-325407... 27 8.9 02_04_0593 + 24177897-24178182,24178442-24178509,24178617-241788... 27 8.9 >03_01_0202 + 1605703-1606402,1606681-1606824,1606911-1607063, 1607236-1607351,1607737-1607904,1607990-1608214, 1608711-1608833 Length = 542 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 184 NLIDPILNMDDHNRDGYIDYPEFVRAQQKS 213 +L++ I++ D N DG IDY EFV Q S Sbjct: 489 SLLEEIISEVDQNNDGQIDYAEFVAMMQGS 518 >12_01_0217 + 1647319-1648327,1648462-1648577,1648650-1648817, 1648911-1649038,1649121-1649220,1649329-1649433 Length = 541 Score = 31.5 bits (68), Expect = 0.55 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 15/106 (14%) Query: 121 SKMSDQELQFHYFKMHDADNNNKLDGCELIKSLIHWHEQGHKQE--------NPPSEAPV 172 +K SD E++ + DAD N +D E + + +H ++ ++ + + + Sbjct: 418 TKFSDNEIE-QLMEAADADGNGIIDYEEFVTATVHMNKMDREEHLYTAFQYFDKDNSGYI 476 Query: 173 G----EKIFNEDEL--VNLIDPILNMDDHNRDGYIDYPEFVRAQQK 212 E+ E L N I ++ D N DG IDY EFV +K Sbjct: 477 TKEELEQALKEQGLYDANEIKDVITDADSNNDGRIDYSEFVAMMRK 522 >11_06_0212 - 21319441-21319498,21319737-21319867,21319944-21320033, 21320141-21320298,21320646-21320721 Length = 170 Score = 30.7 bits (66), Expect = 0.95 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Query: 170 APVGEKIFNEDELVNLIDPILNMDDHNRDGYIDYPEFVRAQQKS 213 A +GE++ EDE ID ++ D N DG +DY EF R + Sbjct: 114 ASLGEEM-TEDE----IDDMMKAADSNNDGQVDYEEFKRVMMST 152 >11_01_0449 - 3473662-3475049,3476026-3476128,3476215-3476439, 3476689-3476856,3477414-3477529,3477640-3477792, 3477879-3478022,3478980-3479583 Length = 966 Score = 29.5 bits (63), Expect = 2.2 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 18/107 (16%) Query: 121 SKMSDQELQFHYFKMHDADNNNKLDGCELIKSLIHWHEQGHKQENPPSEAPVGEK----I 176 S++++ E+Q + D DN+ +D E I + +H ++ ++EN S +K Sbjct: 382 SELTEHEIQA-LMEAADIDNSGTIDYGEFIAATLHMNKL-EREENLVSAFSFFDKDGSGF 439 Query: 177 FNEDEL-----------VNLIDPILNMDDHNRDGYIDYPEFVRAQQK 212 DEL ++L D I ++D +N DG IDY EF +K Sbjct: 440 ITIDELSQACREFGLDDLHLEDMIKDVDQNN-DGQIDYSEFTAMMRK 485 >04_04_0934 + 29504806-29505532,29506059-29506202,29506291-29506443, 29506589-29506704,29507180-29507347,29507716-29507778, 29507827-29508051,29508472-29508594 Length = 572 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 186 IDPILNMDDHNRDGYIDYPEFVRAQQK 212 +D ++N D + DG IDY EFV K Sbjct: 521 LDDVINEADQDNDGRIDYGEFVAMMTK 547 >07_03_1756 - 29239137-29239325,29239741-29240259,29240693-29240800, 29240856-29241155,29241730-29241831,29243042-29243209, 29243878-29243991,29244184-29244288,29244372-29244502, 29244794-29244918,29245001-29245172,29245277-29245316, 29245636-29245722,29245803-29245868,29246412-29246510, 29246714-29246836,29247066-29247107,29247195-29247260, 29247362-29247553,29247672-29247737,29248839-29249141 Length = 1038 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Query: 88 GHTHHGDPQ--LLNPANIAQERDHIQEHMDVPIDTSKM 123 G H GDP LL + Q + + ++DVPID SK+ Sbjct: 541 GRGHSGDPASALLELLDPEQNVNFLDHYLDVPIDLSKV 578 >03_06_0239 - 32578231-32578353,32578431-32578655,32579081-32579248, 32579331-32579446,32579540-32579692,32579779-32579922, 32580775-32581576 Length = 576 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Query: 186 IDPILNMDDHNRDGYIDYPEFVRAQQK 212 I+ I+ D + DG IDY EFV QK Sbjct: 525 IEDIIGDIDQDNDGRIDYNEFVEMMQK 551 >02_05_1339 + 35793795-35794922,35795009-35795233,35795314-35795460 Length = 499 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/27 (48%), Positives = 16/27 (59%) Query: 186 IDPILNMDDHNRDGYIDYPEFVRAQQK 212 ID I+ D + DG IDY EFV +K Sbjct: 440 IDDIIREVDQDNDGRIDYGEFVAMMKK 466 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 181 ELVNLIDPILNMDDHNRDGYIDYPEFVRAQQKS 213 E V L D I +D N DG IDY EFV QK+ Sbjct: 558 EDVRLEDMIGEVDQDN-DGRIDYNEFVAMMQKT 589 >04_04_0349 + 24588184-24588315,24588481-24588543,24588674-24588740, 24588819-24588919,24589082-24589126,24589236-24589697, 24589905-24590075 Length = 346 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Query: 135 MHDADNNNKLDGCELIKSLIHWHEQGHKQENPPSEAPV 172 +H D N + C I +++ EQ ++N PSE+PV Sbjct: 141 VHFQDTNAETIRCRAIPNVLANLEQARDRQNRPSESPV 178 >04_01_0490 - 6440176-6440448,6440785-6441074,6441156-6441304, 6441432-6441890,6441973-6442269,6442604-6443502, 6443793-6443827,6443984-6444078,6444184-6444247, 6446099-6446175,6446330-6446514 Length = 940 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Query: 87 AGHTHHGDPQLLNPANIAQERDHIQEHMDVPIDTS 121 AG T H P + N A+ERD I+ H+ P D S Sbjct: 655 AGSTPHCLPHVRNA--FAEERDRIEHHLSKPKDLS 687 >11_06_0022 + 19321886-19321918,19323059-19323131,19323587-19323680, 19324383-19324499,19324584-19324641,19324713-19325114 Length = 258 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/39 (35%), Positives = 18/39 (46%) Query: 138 ADNNNKLDGCELIKSLIHWHEQGHKQENPPSEAPVGEKI 176 AD L G E + IH E +PP+EAP +I Sbjct: 168 ADQGEALPGEETVPETIHGTESVPPSTHPPAEAPSAAEI 206 >09_04_0557 + 18503380-18503793 Length = 137 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 172 VGEKIFNEDELVNLIDPILNMDDHNRDGYIDYPEFVRAQQK 212 V E + DELV + + DH+ +G +D EF RA+ K Sbjct: 61 VDEAAMSSDELVEMYRGLYARFDHDGNGTVDLEEF-RAEMK 100 >04_04_0786 - 28052981-28053040,28053123-28053222,28053447-28053574, 28053654-28053821,28053901-28054013,28054135-28054287, 28054385-28054528,28054794-28055529 Length = 533 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/27 (44%), Positives = 17/27 (62%) Query: 186 IDPILNMDDHNRDGYIDYPEFVRAQQK 212 I +L+ D ++DG IDY EFV +K Sbjct: 503 IKQVLDEVDKDKDGRIDYEEFVEMMRK 529 >04_04_0419 + 25086456-25086768,25087302-25087369,25087458-25087681, 25087929-25088012,25088593-25088806,25089252-25089428, 25089526-25089645,25089865-25089991,25090104-25090130, 25090526-25091007 Length = 611 Score = 27.9 bits (59), Expect = 6.7 Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 185 LIDPILNMDDHNRDGYIDYPEFVRAQQKSQ 214 ++D I ++ D N DG + EFVRA Q+ + Sbjct: 410 VVDIIFHVFDTNHDGNLSSEEFVRALQRRE 439 >12_01_0450 - 3552701-3552865,3552971-3553195,3553306-3553473, 3554514-3554629,3554735-3554887,3554978-3555121, 3556667-3557276 Length = 526 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 183 VNLIDPILNMDDHNRDGYIDYPEFVRAQQK 212 V+L D I ++D +N DG IDY EF +K Sbjct: 459 VHLEDMIKDVDQNN-DGQIDYSEFAAMMRK 487 >11_04_0105 - 13505786-13505800,13505940-13506043,13506421-13506649, 13506661-13506954,13507139-13507338,13507531-13507585 Length = 298 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 142 NKLDGCELIKSLIHWHEQGHKQENPPSEAP 171 NKL G L+ S ++GHK N P++ P Sbjct: 205 NKLHGVRLLHSNSRSKQEGHKDCNVPTDLP 234 >11_01_0203 - 1610086-1610192,1610620-1610669,1610888-1611348 Length = 205 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 5/48 (10%) Query: 170 APVGEKIFNEDELVNLIDPILNMDDHNRDGYIDYPEFVRAQQKSQKQN 217 A +G+ + ++DEL ++ L+ D + DG I+Y EF++ ++QN Sbjct: 116 ANLGDPL-SDDELADM----LHEADSDGDGQINYNEFLKVMMAKRRQN 158 >10_08_0781 + 20509033-20509714,20510048-20510191,20510604-20510719, 20511356-20511520,20511822-20512043,20512613-20512735 Length = 483 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Query: 194 DHNRDGYIDYPEFVRAQQKS 213 D N DG IDY EFV Q + Sbjct: 440 DQNNDGQIDYAEFVTMMQSN 459 >09_04_0397 + 17273013-17273570 Length = 185 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/23 (39%), Positives = 16/23 (69%) Query: 194 DHNRDGYIDYPEFVRAQQKSQKQ 216 D NRDG++D +F+ +S+K+ Sbjct: 162 DRNRDGFVDMDDFMAMMTRSRKK 184 >07_01_0437 - 3322132-3322251,3322345-3322569,3322953-3323120, 3323207-3323322,3323394-3323546,3323655-3323798, 3324475-3325255 Length = 568 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 186 IDPILNMDDHNRDGYIDYPEFVRAQQK 212 ++ I+ D + DG IDY EFV QK Sbjct: 518 LEDIIKDIDQDNDGRIDYNEFVTMMQK 544 >03_06_0235 + 32539025-32539886,32540330-32540473,32540595-32540747, 32540871-32540986,32541254-32541421,32541534-32541758, 32541884-32542015 Length = 599 Score = 27.5 bits (58), Expect = 8.9 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 183 VNLIDPILNMDDHNRDGYIDYPEFVRAQQK 212 V L + I +D+ N DG IDY EFV QK Sbjct: 543 VQLEEMIREVDEDN-DGRIDYNEFVAMMQK 571 >02_04_0593 + 24177897-24178182,24178442-24178509,24178617-24178840, 24179221-24179304,24180183-24180396,24181242-24181418, 24181507-24181626,24181854-24181998,24182055-24182065, 24182222-24182314 Length = 473 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 185 LIDPILNMDDHNRDGYIDYPEFVRAQQKSQ 214 ++D I + D NRDG + EF+RA Q+ + Sbjct: 401 VVDVIFLVFDANRDGSLSADEFLRALQRRE 430 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.136 0.413 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,998,518 Number of Sequences: 37544 Number of extensions: 189914 Number of successful extensions: 528 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 499 Number of HSP's gapped (non-prelim): 37 length of query: 217 length of database: 14,793,348 effective HSP length: 79 effective length of query: 138 effective length of database: 11,827,372 effective search space: 1632177336 effective search space used: 1632177336 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -