BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001750-TA|BGIBMGA001750-PA|IPR013026|Tetratricopeptide region, IPR001179|Peptidylprolyl isomerase, FKBP-type, IPR001440|Tetratricopeptide TPR_1, IPR013105|Tetratricopeptide TPR_2 (437 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 24 1.8 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 5.6 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 5.6 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 24.2 bits (50), Expect = 1.8 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Query: 265 AVCYYKTN--KPKHVLNMCECLDRLIDTEKHCK 295 A+C T+ P N C+DR+ D E +CK Sbjct: 101 ALCNINTDDCSPNPCRNNGSCVDRIADFECNCK 133 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 5.6 Identities = 7/19 (36%), Positives = 10/19 (52%) Query: 251 LDIKNNKVNAYLNLAVCYY 269 L++ NN Y N+ C Y Sbjct: 99 LEVSNNNFKTYSNVTTCSY 117 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.6 bits (46), Expect = 5.6 Identities = 11/50 (22%), Positives = 21/50 (42%) Query: 259 NAYLNLAVCYYKTNKPKHVLNMCECLDRLIDTEKHCKALYYYGKAHEMLG 308 N Y+ + +YK +L E ++ T+++C Y + H G Sbjct: 79 NYYVIVVTTFYKRRTWTRLLKNLESCAKIKKTKRYCYYYYAFFGVHLAYG 128 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.400 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,802 Number of Sequences: 317 Number of extensions: 3850 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 3 length of query: 437 length of database: 114,650 effective HSP length: 59 effective length of query: 378 effective length of database: 95,947 effective search space: 36267966 effective search space used: 36267966 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -