BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001748-TA|BGIBMGA001748-PA|IPR007205|Protein of unknown function DUF383, IPR007206|Protein of unknown function DUF384 (361 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0147 + 13404711-13404764,13404865-13405232,13406105-134061... 48 1e-05 12_02_0134 - 14071190-14071435,14071800-14071988,14072114-140721... 31 1.4 09_04_0017 + 13821348-13823404,13823546-13823819,13823916-138242... 29 5.8 >10_07_0147 + 13404711-13404764,13404865-13405232,13406105-13406153, 13406374-13406470,13406863-13407011,13407554-13407667, 13408196-13408327,13409143-13409256,13410233-13410454 Length = 432 Score = 48.0 bits (109), Expect = 1e-05 Identities = 59/261 (22%), Positives = 114/261 (43%), Gaps = 19/261 (7%) Query: 63 IAKHALLMLVNISAYTRGATELLKYKPLRYKNI-IDLLISYVLNPNKTDADAACMTLSNI 121 +A+ +++L N++ G LL+ + I + + +LNP+ T + Sbjct: 108 LARSLVMLLANLTQVDSGVAALLQVAHCSFSQIKFHRVNTDILNPDYT------LKFCCF 161 Query: 122 TRLEDELEVCLNTFIPHLNDIMNAFVNTEFNKTGSNL-HYLAPMFSNLACSHRIRKWLCE 180 ++ DE L ++ ++ +F + ++ ++A + N++ R+ L E Sbjct: 162 QKVGDEKMQGL-----YVAKLVRSFCRSSSESEEEDIFEHVASILVNISKVEAGRRILME 216 Query: 181 ENPHVPLIKLIPFCNYDVSNIRKGGAIGTIRNISFDTDYH-EFLVSPDLDLLTYILYPLM 239 P L+K I + + +RK G + TIRN F+ D + L+S + +L P+ Sbjct: 217 --PKRGLLKQIIRQSDSTNQLRKKGVVSTIRNCCFEADTQIQNLLSLAEYIWPALLLPVA 274 Query: 240 GNEDYPDDEMEPLPVTL-QYLPKEKRREPDIDIRILILETLNKLCAQRRG-RPYLRENGV 297 G + Y +++ +P L L E+ + +IR LE + + Q G R + NG Sbjct: 275 GKKIYSEEDRSKMPPELANALSHEREAVENSEIRQQALEAIYMIVLQDEGRRAFWSVNGP 334 Query: 298 YYIMREYHKWEKDPKALIACE 318 + Y E+DPK + A E Sbjct: 335 RILQVGYED-EEDPKVMEAYE 354 >12_02_0134 - 14071190-14071435,14071800-14071988,14072114-14072194, 14072261-14072404,14072528-14072761,14072836-14073981, 14074863-14074922,14075178-14075420,14075509-14075607, 14076196-14076367,14076597-14076735,14077514-14077624, 14077695-14077797,14077885-14077962,14078054-14078122, 14078203-14078275,14078891-14078975,14079473-14079536, 14079963-14080073,14080139-14080213,14080306-14080398, 14080982-14081056,14081172-14081261 Length = 1259 Score = 31.1 bits (67), Expect = 1.4 Identities = 28/95 (29%), Positives = 40/95 (42%), Gaps = 9/95 (9%) Query: 87 YKPLRYKNIIDLLISYVLNPNKTDADAACMTLSNITRLEDELEVCLNTFIPHLNDIMNAF 146 Y L +I+L++ +P+K AC + N D L L IP L ++ A Sbjct: 1085 YSSLATNKVIELVVDRCSDPDKRTRKFACFAVGNAAYHNDMLYEELRRSIPQLTKLLLA- 1143 Query: 147 VNTEFNKTGSNLHYLAPMFSNLACSHRIRKWLCEE 181 E +KT N A SNL + I LCE+ Sbjct: 1144 --PEEDKTKGN---AAGALSNLVRNSNI---LCED 1170 >09_04_0017 + 13821348-13823404,13823546-13823819,13823916-13824238, 13824491-13824604,13825357-13825422,13825638-13825764 Length = 986 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/45 (26%), Positives = 24/45 (53%) Query: 315 IACENVVDILIQKEDEVGAEDLSTVEVPEELRERFNKTNSDFMMN 359 I + +++++ ED V D + +P LR+RFN+ F ++ Sbjct: 207 IFADKILEVISPDEDYVWVHDYHLMILPTFLRKRFNRVKLGFFLH 251 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.320 0.139 0.407 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,605,368 Number of Sequences: 37544 Number of extensions: 463478 Number of successful extensions: 1016 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 1014 Number of HSP's gapped (non-prelim): 3 length of query: 361 length of database: 14,793,348 effective HSP length: 83 effective length of query: 278 effective length of database: 11,677,196 effective search space: 3246260488 effective search space used: 3246260488 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -