BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001747-TA|BGIBMGA001747-PA|undefined (227 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.12 |set9||histone lysine methyltransferase Set9|Schizosa... 32 0.060 SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces po... 27 1.7 >SPCC4B3.12 |set9||histone lysine methyltransferase Set9|Schizosaccharomyces pombe|chr 3|||Manual Length = 441 Score = 32.3 bits (70), Expect = 0.060 Identities = 18/58 (31%), Positives = 29/58 (50%) Query: 151 KSLYHVCATSDECGDELICGVPNITSTAPDHLYVHSPQEKICLCDTDSGFKEKDHACS 208 K L+H ATS C + V +++S + YV S +++ L DSG + D + S Sbjct: 246 KKLFHTSATSTSCSSKSSSDVSDLSSLPQSNRYVISEEDRSFLNIWDSGGELSDASSS 303 >SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 27.5 bits (58), Expect = 1.7 Identities = 11/40 (27%), Positives = 21/40 (52%) Query: 173 NITSTAPDHLYVHSPQEKICLCDTDSGFKEKDHACSASIC 212 +I+ T P H ++ Q ++C D +S ++H S +C Sbjct: 347 HISKTGPTHSFIIYIQMQLCFDDLESYLIRRNHFLSFPLC 386 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.322 0.133 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 920,366 Number of Sequences: 5004 Number of extensions: 33056 Number of successful extensions: 49 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 47 Number of HSP's gapped (non-prelim): 2 length of query: 227 length of database: 2,362,478 effective HSP length: 70 effective length of query: 157 effective length of database: 2,012,198 effective search space: 315915086 effective search space used: 315915086 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -