BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001742-TA|BGIBMGA001742-PA|IPR000727|Target SNARE coiled-coil region, IPR010989|t-snare, IPR006012|Syntaxin/epimorphin family (338 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 22 6.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 8.7 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.2 bits (45), Expect = 6.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Query: 62 RRLYSDPNYHTNRQLQEQLDRAVTQSNALGLKV 94 +RLY D + NR ++ ++ T + LGLK+ Sbjct: 35 KRLYDDLLSNYNRLIRPVMNNTETLTVQLGLKL 67 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.8 bits (44), Expect = 8.7 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 24 TVQLDPHDTSDDKIHTMFQEVERMRGW-IRD 53 T+Q D D+ + +FQ + R + IRD Sbjct: 289 TIQEKRDDAKDESVEAIFQSILRQKNLDIRD 319 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.133 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,110 Number of Sequences: 429 Number of extensions: 2187 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 338 length of database: 140,377 effective HSP length: 58 effective length of query: 280 effective length of database: 115,495 effective search space: 32338600 effective search space used: 32338600 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -