GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001742-TA|BGIBMGA001742-PA|IPR000727|Target SNARE
coiled-coil region, IPR010989|t-snare, IPR006012|Syntaxin/epimorphin
family
         (338 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less prot...    21   9.7  

>AF317551-1|AAG39634.1|  312|Tribolium castaneum distal-less
           protein.
          Length = 312

 Score = 21.4 bits (43), Expect = 9.7
 Identities = 13/44 (29%), Positives = 17/44 (38%)

Query: 33  SDDKIHTMFQEVERMRGWIRDLDDNTQLVRRLYSDPNYHTNRQL 76
           + D++H       R R   R   DN  LV    S P+    R L
Sbjct: 230 TSDRVHAALVTSPRARPLARTCRDNRLLVLAGTSSPSNRFTRHL 273


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.133    0.398 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,011
Number of Sequences: 317
Number of extensions: 1791
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 338
length of database: 114,650
effective HSP length: 57
effective length of query: 281
effective length of database: 96,581
effective search space: 27139261
effective search space used: 27139261
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)