BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001742-TA|BGIBMGA001742-PA|IPR000727|Target SNARE
coiled-coil region, IPR010989|t-snare, IPR006012|Syntaxin/epimorphin
family
(338 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 9.7
>AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less
protein.
Length = 312
Score = 21.4 bits (43), Expect = 9.7
Identities = 13/44 (29%), Positives = 17/44 (38%)
Query: 33 SDDKIHTMFQEVERMRGWIRDLDDNTQLVRRLYSDPNYHTNRQL 76
+ D++H R R R DN LV S P+ R L
Sbjct: 230 TSDRVHAALVTSPRARPLARTCRDNRLLVLAGTSSPSNRFTRHL 273
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.321 0.133 0.398
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 59,011
Number of Sequences: 317
Number of extensions: 1791
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 338
length of database: 114,650
effective HSP length: 57
effective length of query: 281
effective length of database: 96,581
effective search space: 27139261
effective search space used: 27139261
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 43 (21.4 bits)
- SilkBase 1999-2023 -