BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001737-TA|BGIBMGA001737-PA|undefined (180 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.5 U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II p... 21 5.9 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 7.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 1.5 Identities = 9/34 (26%), Positives = 14/34 (41%) Query: 66 VDGDEDTELYGPPQYSPSRIAPDDEHQTNEDQTD 99 V+ E+ PP S + P +H T + D Sbjct: 1785 VEAVEEEREEAPPSVHSSTVVPPPQHSTTQSLVD 1818 >U04271-2|AAA03709.1| 490|Tribolium castaneum alpha-amylase II protein. Length = 490 Score = 21.0 bits (42), Expect = 5.9 Identities = 6/20 (30%), Positives = 12/20 (60%) Query: 14 SIDVENDEPSASGFGAEYQW 33 S + +D +G+G E++W Sbjct: 364 SPSINDDGTCGNGYGCEHRW 383 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/35 (25%), Positives = 14/35 (40%) Query: 77 PPQYSPSRIAPDDEHQTNEDQTDMQTTNETETEDR 111 PPQ + D T D+ + TT+ D+ Sbjct: 35 PPQSPNQQYTKDCSSPTPSDKLNTSTTSSVNVNDQ 69 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.309 0.125 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,748 Number of Sequences: 317 Number of extensions: 1631 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 180 length of database: 114,650 effective HSP length: 53 effective length of query: 127 effective length of database: 97,849 effective search space: 12426823 effective search space used: 12426823 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.3 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -