BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001733-TA|BGIBMGA001733-PA|undefined (185 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 25 1.1 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.5 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 25.4 bits (53), Expect = 1.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 112 EGQRLFMAIARVIDDVSWAGQSIRVY 137 +G+RL+ IA + DDVS +R+Y Sbjct: 157 KGRRLWFGIANIEDDVSVLMAELRLY 182 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 7.5 Identities = 11/35 (31%), Positives = 17/35 (48%) Query: 15 VATRTCYNENIEGEVLAFDPQTKMLILKCQSSSGN 49 VA R YN +++ L+F + L C + S N Sbjct: 1598 VALRFVYNTSVDDSKLSFSWNGQEFNLFCSTGSSN 1632 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.132 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,765 Number of Sequences: 2123 Number of extensions: 6447 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 185 length of database: 516,269 effective HSP length: 60 effective length of query: 125 effective length of database: 388,889 effective search space: 48611125 effective search space used: 48611125 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -