BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001732-TA|BGIBMGA001732-PA|undefined (214 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U15174-1|AAC00022.1| 194|Homo sapiens BCL2/adenovirus E1B 19kD-... 51 3e-06 BC080643-1|AAH80643.1| 228|Homo sapiens BNIP3 protein protein. 51 3e-06 BC067818-1|AAH67818.1| 244|Homo sapiens BNIP3 protein protein. 51 3e-06 BC021989-1|AAH21989.1| 194|Homo sapiens BCL2/adenovirus E1B 19k... 51 3e-06 AY886764-1|AAW62256.1| 194|Homo sapiens BCL2/adenovirus E1B 19k... 51 3e-06 AL162274-1|CAD13201.1| 194|Homo sapiens BCL2/adenovirus E1B 19k... 51 3e-06 AK222626-1|BAD96346.1| 194|Homo sapiens BCL2/adenovirus E1B 19k... 51 3e-06 AF002697-1|AAC16738.1| 194|Homo sapiens E1B 19K/Bcl-2-binding p... 51 3e-06 CR456701-1|CAG32982.1| 219|Homo sapiens BNIP3L protein. 46 1e-04 BT019501-1|AAV38308.1| 219|Homo sapiens BCL2/adenovirus E1B 19k... 46 1e-04 BT019500-1|AAV38307.1| 219|Homo sapiens BCL2/adenovirus E1B 19k... 46 1e-04 BC009603-1|AAH09603.1| 219|Homo sapiens BCL2/adenovirus E1B 19k... 46 1e-04 BC001559-1|AAH01559.1| 219|Homo sapiens BCL2/adenovirus E1B 19k... 46 1e-04 AF536326-1|AAN04051.1| 219|Homo sapiens adenovirus E1B19k-bindi... 46 1e-04 AF452712-1|AAL50978.1| 219|Homo sapiens pro-apoptotic protein p... 46 1e-04 AF255051-1|AAF70290.1| 219|Homo sapiens BNIP3H protein. 46 1e-04 AF079221-1|AAC27723.1| 219|Homo sapiens BCL2/adenovirus E1B 19k... 46 1e-04 AF067396-1|AAD03589.1| 219|Homo sapiens NIX protein. 46 1e-04 AF060922-1|AAG43134.1| 230|Homo sapiens My020 protein protein. 46 1e-04 AB004788-1|BAA28692.1| 219|Homo sapiens BNIP3L protein. 46 1e-04 U32439-1|AAC50351.1| 420|Homo sapiens RGS7 protein. 30 7.0 BC022009-1|AAH22009.1| 487|Homo sapiens regulator of G-protein ... 30 7.0 AY587875-1|AAT52231.1| 469|Homo sapiens regulator of G-protein ... 30 7.0 AL590682-5|CAH73812.1| 477|Homo sapiens regulator of G-protein ... 30 7.0 AL590682-4|CAH73811.1| 424|Homo sapiens regulator of G-protein ... 30 7.0 AL590682-3|CAH73810.1| 487|Homo sapiens regulator of G-protein ... 30 7.0 AL590682-2|CAH73809.1| 469|Homo sapiens regulator of G-protein ... 30 7.0 AL512307-4|CAH71990.1| 477|Homo sapiens regulator of G-protein ... 30 7.0 AL512307-3|CAH71989.1| 424|Homo sapiens regulator of G-protein ... 30 7.0 AL512307-2|CAH71987.1| 487|Homo sapiens regulator of G-protein ... 30 7.0 AL512307-1|CAH71988.1| 469|Homo sapiens regulator of G-protein ... 30 7.0 AL365184-7|CAI16824.1| 326|Homo sapiens regulator of G-protein ... 30 7.0 AL365184-4|CAI16820.1| 424|Homo sapiens regulator of G-protein ... 30 7.0 AL365184-3|CAI16821.1| 477|Homo sapiens regulator of G-protein ... 30 7.0 AL365184-2|CAI16819.1| 469|Homo sapiens regulator of G-protein ... 30 7.0 AL365184-1|CAI16818.1| 487|Homo sapiens regulator of G-protein ... 30 7.0 AL359764-4|CAI15143.1| 424|Homo sapiens regulator of G-protein ... 30 7.0 AL359764-3|CAI15142.1| 477|Homo sapiens regulator of G-protein ... 30 7.0 AL359764-2|CAI15141.1| 469|Homo sapiens regulator of G-protein ... 30 7.0 AL359764-1|CAI15140.1| 487|Homo sapiens regulator of G-protein ... 30 7.0 AF493931-1|AAM12645.1| 477|Homo sapiens regulator of G protein ... 30 7.0 AF493930-1|AAM12644.1| 424|Homo sapiens regulator of G protein ... 30 7.0 AF090117-1|AAD34291.1| 326|Homo sapiens regulator of G-protein ... 30 7.0 AF090116-1|AAD34290.1| 469|Homo sapiens regulator of G-protein ... 30 7.0 U37673-1|AAC50219.1| 1081|Homo sapiens beta-NAP protein. 29 9.2 BC093739-1|AAH93739.1| 1082|Homo sapiens adaptor-related protein... 29 9.2 AJ005821-1|CAA06718.2| 3027|Homo sapiens X-like 1 protein protein. 29 9.2 AF022152-1|AAB71894.1| 1082|Homo sapiens AP-3 complex beta3B sub... 29 9.2 >U15174-1|AAC00022.1| 194|Homo sapiens BCL2/adenovirus E1B 19kD-interacting protein 3 protein. Length = 194 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 113 NSDWIWDWSSRPENIPPKEFLFKHPK 138 >BC080643-1|AAH80643.1| 228|Homo sapiens BNIP3 protein protein. Length = 228 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 147 NSDWIWDWSSRPENIPPKEFLFKHPK 172 >BC067818-1|AAH67818.1| 244|Homo sapiens BNIP3 protein protein. Length = 244 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 163 NSDWIWDWSSRPENIPPKEFLFKHPK 188 >BC021989-1|AAH21989.1| 194|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3 protein. Length = 194 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 113 NSDWIWDWSSRPENIPPKEFLFKHPK 138 >AY886764-1|AAW62256.1| 194|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3 protein. Length = 194 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 113 NSDWIWDWSSRPENIPPKEFLFKHPK 138 >AL162274-1|CAD13201.1| 194|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3 protein. Length = 194 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 113 NSDWIWDWSSRPENIPPKEFLFKHPK 138 >AK222626-1|BAD96346.1| 194|Homo sapiens BCL2/adenovirus E1B 19kD-interacting protein 3 variant protein. Length = 194 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 113 NSDWIWDWSSRPENIPPKEFLFKHPK 138 >AF002697-1|AAC16738.1| 194|Homo sapiens E1B 19K/Bcl-2-binding protein Nip3 protein. Length = 194 Score = 51.2 bits (117), Expect = 3e-06 Identities = 15/26 (57%), Positives = 24/26 (92%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 ++DW+W+WSSRP+ +PPK++ FKHP+ Sbjct: 113 NSDWIWDWSSRPENIPPKEFLFKHPK 138 >CR456701-1|CAG32982.1| 219|Homo sapiens BNIP3L protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >BT019501-1|AAV38308.1| 219|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3-like protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >BT019500-1|AAV38307.1| 219|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3-like protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >BC009603-1|AAH09603.1| 219|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3-like protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >BC001559-1|AAH01559.1| 219|Homo sapiens BCL2/adenovirus E1B 19kDa interacting protein 3-like protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >AF536326-1|AAN04051.1| 219|Homo sapiens adenovirus E1B19k-binding protein B5 protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >AF452712-1|AAL50978.1| 219|Homo sapiens pro-apoptotic protein protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >AF255051-1|AAF70290.1| 219|Homo sapiens BNIP3H protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >AF079221-1|AAC27723.1| 219|Homo sapiens BCL2/adenovirus E1B 19kDa-interacting protein 3a protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >AF067396-1|AAD03589.1| 219|Homo sapiens NIX protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >AF060922-1|AAG43134.1| 230|Homo sapiens My020 protein protein. Length = 230 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >AB004788-1|BAA28692.1| 219|Homo sapiens BNIP3L protein. Length = 219 Score = 45.6 bits (103), Expect = 1e-04 Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 101 SNDWVWEWSSRPDQLPPKDWRFKHPQ 126 S DWV +WSSRP+ +PPK++ F+HP+ Sbjct: 137 SADWVSDWSSRPENIPPKEFHFRHPK 162 >U32439-1|AAC50351.1| 420|Homo sapiens RGS7 protein. Length = 420 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 255 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 307 >BC022009-1|AAH22009.1| 487|Homo sapiens regulator of G-protein signalling 7 protein. Length = 487 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AY587875-1|AAT52231.1| 469|Homo sapiens regulator of G-protein signaling RGS7 protein. Length = 469 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL590682-5|CAH73812.1| 477|Homo sapiens regulator of G-protein signalling 7 protein. Length = 477 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL590682-4|CAH73811.1| 424|Homo sapiens regulator of G-protein signalling 7 protein. Length = 424 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 251 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 303 >AL590682-3|CAH73810.1| 487|Homo sapiens regulator of G-protein signalling 7 protein. Length = 487 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL590682-2|CAH73809.1| 469|Homo sapiens regulator of G-protein signalling 7 protein. Length = 469 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL512307-4|CAH71990.1| 477|Homo sapiens regulator of G-protein signalling 7 protein. Length = 477 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL512307-3|CAH71989.1| 424|Homo sapiens regulator of G-protein signalling 7 protein. Length = 424 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 251 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 303 >AL512307-2|CAH71987.1| 487|Homo sapiens regulator of G-protein signalling 7 protein. Length = 487 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL512307-1|CAH71988.1| 469|Homo sapiens regulator of G-protein signalling 7 protein. Length = 469 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL365184-7|CAI16824.1| 326|Homo sapiens regulator of G-protein signalling 7 protein. Length = 326 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 135 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 187 >AL365184-4|CAI16820.1| 424|Homo sapiens regulator of G-protein signalling 7 protein. Length = 424 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 251 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 303 >AL365184-3|CAI16821.1| 477|Homo sapiens regulator of G-protein signalling 7 protein. Length = 477 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL365184-2|CAI16819.1| 469|Homo sapiens regulator of G-protein signalling 7 protein. Length = 469 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL365184-1|CAI16818.1| 487|Homo sapiens regulator of G-protein signalling 7 protein. Length = 487 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL359764-4|CAI15143.1| 424|Homo sapiens regulator of G-protein signalling 7 protein. Length = 424 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 251 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 303 >AL359764-3|CAI15142.1| 477|Homo sapiens regulator of G-protein signalling 7 protein. Length = 477 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL359764-2|CAI15141.1| 469|Homo sapiens regulator of G-protein signalling 7 protein. Length = 469 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AL359764-1|CAI15140.1| 487|Homo sapiens regulator of G-protein signalling 7 protein. Length = 487 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AF493931-1|AAM12645.1| 477|Homo sapiens regulator of G protein signalling 7 protein. Length = 477 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >AF493930-1|AAM12644.1| 424|Homo sapiens regulator of G protein signalling 7 protein. Length = 424 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 251 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 303 >AF090117-1|AAD34291.1| 326|Homo sapiens regulator of G-protein signaling 7b protein. Length = 326 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 135 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 187 >AF090116-1|AAD34290.1| 469|Homo sapiens regulator of G-protein signaling 7 protein. Length = 469 Score = 29.9 bits (64), Expect = 7.0 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 95 NCW-RDDSNDWVWEWSSRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLEQQLA 146 N W DD+ W E S P Q K W F ++++ P ++ LE + + Sbjct: 304 NPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFS 356 >U37673-1|AAC50219.1| 1081|Homo sapiens beta-NAP protein. Length = 1081 Score = 29.5 bits (63), Expect = 9.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 110 SRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLE-QQLAPPVMQ 151 S +QL P W K P S + P AT I +L+ + PP +Q Sbjct: 778 SEEEQLEPASWSRKTPPSSKSAP-ATKEISLLDLEDFTPPSVQ 819 >BC093739-1|AAH93739.1| 1082|Homo sapiens adaptor-related protein complex 3, beta 2 subunit protein. Length = 1082 Score = 29.5 bits (63), Expect = 9.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 110 SRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLE-QQLAPPVMQ 151 S +QL P W K P S + P AT I +L+ + PP +Q Sbjct: 779 SEEEQLEPASWSRKTPPSSKSAP-ATKEISLLDLEDFTPPSVQ 820 >AJ005821-1|CAA06718.2| 3027|Homo sapiens X-like 1 protein protein. Length = 3027 Score = 29.5 bits (63), Expect = 9.2 Identities = 13/24 (54%), Positives = 19/24 (79%) Query: 34 GGGLAAVENEYIRLLREAQRESRD 57 GGGLA+V E I LL+E+Q+E+ + Sbjct: 2144 GGGLASVRMELILLLQESQQETSE 2167 >AF022152-1|AAB71894.1| 1082|Homo sapiens AP-3 complex beta3B subunit protein. Length = 1082 Score = 29.5 bits (63), Expect = 9.2 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 110 SRPDQLPPKDWRFKHPQSVRGPPSATSSIEVLE-QQLAPPVMQ 151 S +QL P W K P S + P AT I +L+ + PP +Q Sbjct: 779 SEEEQLEPASWSRKTPPSSKSAP-ATKEISLLDLEDFTPPSVQ 820 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.318 0.132 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,977,778 Number of Sequences: 224733 Number of extensions: 1161450 Number of successful extensions: 2537 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 27 Number of HSP's that attempted gapping in prelim test: 2516 Number of HSP's gapped (non-prelim): 48 length of query: 214 length of database: 73,234,838 effective HSP length: 87 effective length of query: 127 effective length of database: 53,683,067 effective search space: 6817749509 effective search space used: 6817749509 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -