BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001732-TA|BGIBMGA001732-PA|undefined (214 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 5.6 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Query: 2 LFSSISAFTTSNQHFLGLPWVLGLKSWVELNSGGGLAAVENEYIRL 47 LF I T + +L + W G+K+ + + + EY++L Sbjct: 1278 LFVLIVFLLTLKKDYLHIKWPFGVKTNITYDESTQEVHISKEYLQL 1323 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/46 (23%), Positives = 21/46 (45%) Query: 2 LFSSISAFTTSNQHFLGLPWVLGLKSWVELNSGGGLAAVENEYIRL 47 LF I T + +L + W G+K+ + + + EY++L Sbjct: 1278 LFVLIVFLLTLKKDYLHIKWPFGVKTNITYDESTQEVHISKEYLQL 1323 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 5.6 Identities = 10/46 (21%), Positives = 20/46 (43%) Query: 131 PPSATSSIEVLEQQLAPPVMQQSHCLSVRRTCLFSRGAIVAVLATN 176 PP + L QQSH L + F+R ++ +++++ Sbjct: 139 PPQTAAMAAYLNAAAVAAAAQQSHRLMMTSPSGFNRASVSPLISSS 184 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.132 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,685 Number of Sequences: 317 Number of extensions: 1651 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 214 length of database: 114,650 effective HSP length: 54 effective length of query: 160 effective length of database: 97,532 effective search space: 15605120 effective search space used: 15605120 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -