GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001731-TA|BGIBMGA001731-PA|undefined
         (104 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    21   3.4  

>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 20.6 bits (41), Expect = 3.4
 Identities = 10/36 (27%), Positives = 19/36 (52%)

Query: 26  FLLEHKDDFPEAELVTLAQIYTNIEFLGCRYPPQTM 61
           FL + KD+ PE  L  ++ +    E +G +   Q++
Sbjct: 371 FLTQLKDECPEVRLNIISNLDCVNEVIGIQQLSQSL 406


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.314    0.128    0.352 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,009
Number of Sequences: 317
Number of extensions: 658
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 104
length of database: 114,650
effective HSP length: 49
effective length of query: 55
effective length of database: 99,117
effective search space:  5451435
effective search space used:  5451435
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.2 bits)
S2: 38 (19.4 bits)