BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001731-TA|BGIBMGA001731-PA|undefined (104 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 24 1.3 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 22 4.0 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.8 bits (49), Expect = 1.3 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Query: 31 KDDFPEAELVTLAQIYTNIEFLGCRYPPQTMKRISVLAEKVSAKYKESRKNKLKRTF 87 ++ PEA + + F CRYP Q MK ++ + ++ + + + + +KR F Sbjct: 264 RESIPEAYFPKIVRSSDGRAF-SCRYPNQVMKDVNRVEDESTIRLADMDVS-IKRIF 318 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 22.2 bits (45), Expect = 4.0 Identities = 14/44 (31%), Positives = 18/44 (40%) Query: 61 MKRISVLAEKVSAKYKESRKNKLKRTFVQASDAAEQKAKRTFKK 104 +KR + E K L+R VQ D +QKA T K Sbjct: 355 VKRAAFENEVAGESKKRGSNVHLERDLVQEYDRLKQKADATSSK 398 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.314 0.128 0.352 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,193 Number of Sequences: 2123 Number of extensions: 2903 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 104 length of database: 516,269 effective HSP length: 55 effective length of query: 49 effective length of database: 399,504 effective search space: 19575696 effective search space used: 19575696 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -