GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001724-TA|BGIBMGA001724-PA|undefined
         (468 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    28   3.2  

>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 27.9 bits (59), Expect = 3.2
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 264 PQESNVKF-VYGQAPAGTFLVKPGQVRFPRPQPILVRPGKITLPTPPSIYV 313
           P  ++V+F      P G  +V  G+ RF   +PI  RP   T+  P +IY+
Sbjct: 334 PDNTDVEFQTIAIEPLGDCIV--GRERFKICEPIFHRPSNETVSLPEAIYI 382


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.321    0.139    0.443 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,487,502
Number of Sequences: 5004
Number of extensions: 50096
Number of successful extensions: 107
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 107
Number of HSP's gapped (non-prelim): 1
length of query: 468
length of database: 2,362,478
effective HSP length: 75
effective length of query: 393
effective length of database: 1,987,178
effective search space: 780960954
effective search space used: 780960954
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 55 (26.2 bits)