BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001715-TA|BGIBMGA001715-PA|IPR013069|BTB/POZ, IPR000210|BTB (517 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC047071-1|AAH47071.1| 410|Homo sapiens BTB (POZ) domain contai... 62 6e-09 AK001510-1|BAA91730.1| 410|Homo sapiens protein ( Homo sapiens ... 62 6e-09 AB040958-1|BAA96049.2| 1135|Homo sapiens KIAA1525 protein protein. 62 6e-09 BC141850-1|AAI41851.1| 410|Homo sapiens BTB (POZ) domain contai... 61 1e-08 AK021953-1|BAB13946.1| 364|Homo sapiens protein ( Homo sapiens ... 54 9e-07 BX538231-1|CAD98074.1| 530|Homo sapiens hypothetical protein pr... 54 1e-06 BC015649-1|AAH15649.1| 587|Homo sapiens BTB (POZ) domain contai... 44 0.002 AL591038-1|CAI11059.1| 587|Homo sapiens BTB (POZ) domain contai... 44 0.002 AL355574-2|CAI14117.1| 587|Homo sapiens BTB (POZ) domain contai... 44 0.002 BC055396-1|AAH55396.1| 527|Homo sapiens BTBD14B protein protein. 42 0.005 AF395817-1|AAK83885.1| 527|Homo sapiens NAC1 protein protein. 42 0.005 D38496-1|BAA07508.1| 552|Homo sapiens LZTR-1 protein. 40 0.028 CT841521-1|CAJ86451.1| 840|Homo sapiens LZTR1 protein. 40 0.028 BC026214-1|AAH26214.2| 840|Homo sapiens leucine-zipper-like tra... 40 0.028 AK127080-1|BAC86816.1| 799|Homo sapiens protein ( Homo sapiens ... 40 0.028 BX088650-17|CAM26308.1| 473|Homo sapiens zinc finger and BTB do... 39 0.037 BC014978-1|AAH14978.1| 473|Homo sapiens zinc finger and BTB dom... 39 0.037 AL662799-17|CAM25574.1| 473|Homo sapiens zinc finger and BTB do... 39 0.037 BC021267-1|AAH21267.1| 388|Homo sapiens KLHL14 protein protein. 39 0.049 AB037805-1|BAA92622.1| 652|Homo sapiens KIAA1384 protein protein. 39 0.049 U69274-1|AAD00172.1| 1053|Homo sapiens zinc finger protein protein. 37 0.20 BC111700-1|AAI11701.1| 1053|Homo sapiens zinc finger and BTB dom... 37 0.20 BC131774-1|AAI31775.1| 100|Homo sapiens ZBTB4 protein protein. 36 0.46 BC043352-1|AAH43352.1| 1013|Homo sapiens zinc finger and BTB dom... 36 0.46 AY302699-1|AAP59447.1| 1013|Homo sapiens KAISO-like zinc finger ... 36 0.46 AB040971-1|BAA96062.2| 1029|Homo sapiens KIAA1538 protein protein. 36 0.46 Z97184-1|CAB09990.1| 634|Homo sapiens zinc finger protein 297 p... 35 0.80 BX248088-6|CAM25704.1| 149|Homo sapiens zinc finger and BTB dom... 35 0.80 BX248088-5|CAI41787.2| 634|Homo sapiens zinc finger and BTB dom... 35 0.80 BC018541-1|AAH18541.1| 634|Homo sapiens zinc finger and BTB dom... 35 0.80 AL662827-13|CAM24890.1| 149|Homo sapiens zinc finger and BTB do... 35 0.80 AL662827-12|CAI17526.1| 634|Homo sapiens zinc finger and BTB do... 35 0.80 AL662820-13|CAM25474.1| 149|Homo sapiens zinc finger and BTB do... 35 0.80 AL662820-12|CAI18123.1| 634|Homo sapiens zinc finger and BTB do... 35 0.80 CR450303-1|CAG29299.1| 736|Homo sapiens r 1; complete cds; with... 34 1.1 BC063307-1|AAH63307.1| 736|Homo sapiens BTB and CNC homology 1,... 34 1.1 AY346333-1|AAQ24383.1| 305|Homo sapiens double BTB/POZ domain c... 34 1.1 AL163249-6|CAB90435.1| 78|Homo sapiens transcription regulator... 34 1.1 AF124731-1|AAD14689.1| 736|Homo sapiens BACH1 protein. 34 1.1 AF026199-1|AAB84100.1| 736|Homo sapiens transcription regulator... 34 1.1 AB002803-1|BAA24932.1| 736|Homo sapiens BACH1 protein. 34 1.1 BC036468-1|AAH36468.1| 593|Homo sapiens kelch-like 2, Mayven (D... 33 1.8 BC022503-1|AAH22503.1| 593|Homo sapiens kelch-like 2, Mayven (D... 33 1.8 BC012070-1|AAH12070.1| 539|Homo sapiens ZBTB7B protein protein. 33 1.8 AL451085-29|CAI13266.1| 539|Homo sapiens zinc finger and BTB do... 33 1.8 AF059569-1|AAC67502.1| 593|Homo sapiens actin binding protein M... 33 1.8 AF007833-1|AAC51847.1| 539|Homo sapiens kruppel-related zinc fi... 33 1.8 BT007194-1|AAP35858.1| 467|Homo sapiens zinc finger protein 297... 33 2.4 BC008828-1|AAH08828.1| 467|Homo sapiens zinc finger and BTB dom... 33 2.4 AL161731-4|CAI40920.1| 467|Homo sapiens zinc finger and BTB dom... 33 2.4 AL161731-3|CAI40919.1| 196|Homo sapiens zinc finger and BTB dom... 33 2.4 AF049907-1|AAC05500.1| 467|Homo sapiens zinc finger transcripti... 33 2.4 AB007874-1|BAA24844.2| 492|Homo sapiens KIAA0414 protein. 33 2.4 BC059404-1|AAH59404.1| 480|Homo sapiens B-cell CLL/lymphoma 6, ... 33 3.2 BC013922-1|AAH13922.1| 378|Homo sapiens BTB (POZ) domain contai... 33 3.2 AL353692-4|CAI16237.1| 841|Homo sapiens BTB and CNC homology 1,... 33 3.2 AL121787-2|CAI21648.1| 841|Homo sapiens BTB and CNC homology 1,... 33 3.2 AL121787-1|CAD92600.1| 81|Homo sapiens BTB and CNC homology 1,... 33 3.2 AJ271878-1|CAC28130.1| 841|Homo sapiens putative transcription ... 33 3.2 AF357835-1|AAK48898.1| 841|Homo sapiens BACH2 transcription fac... 33 3.2 AB208889-1|BAD92126.1| 857|Homo sapiens BTB and CNC homology 1,... 33 3.2 AB076581-1|BAC00963.1| 480|Homo sapiens BAZF protein. 33 3.2 AB076580-1|BAC00962.1| 480|Homo sapiens BAZF protein. 33 3.2 CR589949-2|CAM12888.1| 584|Homo sapiens intracisternal A partic... 32 4.2 CR589949-1|CAM12887.1| 582|Homo sapiens intracisternal A partic... 32 4.2 BX664740-2|CAM12889.1| 584|Homo sapiens intracisternal A partic... 32 4.2 BX664740-1|CAI23599.2| 582|Homo sapiens intracisternal A partic... 32 4.2 BC071627-1|AAH71627.1| 470|Homo sapiens KLHL32 protein protein. 32 4.2 BC032544-1|AAH32544.1| 582|Homo sapiens IPP protein protein. 32 4.2 BC031830-1|AAH31830.1| 139|Homo sapiens KLHL32 protein protein. 32 4.2 AL604028-4|CAM12886.1| 584|Homo sapiens intracisternal A partic... 32 4.2 AL604028-3|CAM12885.1| 582|Homo sapiens intracisternal A partic... 32 4.2 AL356958-1|CAI21654.1| 620|Homo sapiens RP1-39B17.1 protein. 32 4.2 AL033375-2|CAI19824.1| 620|Homo sapiens RP1-39B17.1 protein. 32 4.2 AL033375-1|CAI19823.1| 139|Homo sapiens RP1-39B17.1 protein. 32 4.2 AL023656-3|CAI20428.1| 620|Homo sapiens RP1-39B17.1 protein. 32 4.2 AL023656-2|CAI20427.1| 139|Homo sapiens RP1-39B17.1 protein. 32 4.2 AK055292-1|BAB70899.1| 620|Homo sapiens protein ( Homo sapiens ... 32 4.2 AF156857-1|AAD39007.1| 584|Homo sapiens actin-binding protein p... 32 4.2 AB067487-1|BAB67793.1| 582|Homo sapiens KIAA1900 protein protein. 32 4.2 DQ227306-1|ABA86591.1| 504|Homo sapiens zinc finger and BTB dom... 32 5.6 BX248409-2|CAH73000.1| 609|Homo sapiens kelch-like 20 (Drosophi... 32 5.6 BC109031-1|AAI09032.1| 644|Homo sapiens kelch-like 34 (Drosophi... 32 5.6 BC063418-1|AAH63418.1| 609|Homo sapiens kelch-like 20 (Drosophi... 32 5.6 BC034470-1|AAH34470.1| 708|Homo sapiens kelch-like 11 (Drosophi... 32 5.6 BC006315-1|AAH06315.1| 361|Homo sapiens zinc finger and BTB dom... 32 5.6 BC005253-1|AAH05253.1| 230|Homo sapiens KLHL20 protein protein. 32 5.6 BC003116-1|AAH03116.1| 361|Homo sapiens zinc finger and BTB dom... 32 5.6 AY762229-1|AAW83120.1| 623|Homo sapiens chronic myelogenous leu... 32 5.6 AL772392-1|CAI40764.1| 644|Homo sapiens novel protein protein. 32 5.6 AL354944-1|CAH69994.1| 504|Homo sapiens zinc finger and BTB dom... 32 5.6 AL136170-6|CAI19422.1| 503|Homo sapiens zinc finger and BTB dom... 32 5.6 AL136170-5|CAI19421.1| 308|Homo sapiens zinc finger and BTB dom... 32 5.6 AL136170-4|CAI19420.1| 361|Homo sapiens zinc finger and BTB dom... 32 5.6 AL109921-1|CAI20377.1| 609|Homo sapiens kelch-like 20 (Drosophi... 32 5.6 AK092279-1|BAC03848.1| 644|Homo sapiens protein ( Homo sapiens ... 32 5.6 AK057310-1|BAB71422.1| 308|Homo sapiens protein ( Homo sapiens ... 32 5.6 AK001434-1|BAA91689.1| 708|Homo sapiens protein ( Homo sapiens ... 32 5.6 AJ844466-1|CAH59617.1| 609|Homo sapiens KLEIP (kelch-like ECT2 ... 32 5.6 AB082524-1|BAC02702.1| 532|Homo sapiens KIAA1993 protein protein. 32 5.6 AB026190-1|BAA77027.1| 609|Homo sapiens Kelch motif containing ... 32 5.6 AB018254-1|BAA34431.2| 661|Homo sapiens KIAA0711 protein protein. 32 5.6 BC113511-1|AAI13512.1| 584|Homo sapiens zinc finger and BTB dom... 31 7.4 BC109087-1|AAI09088.1| 765|Homo sapiens zinc finger protein 509... 31 7.4 BC091648-1|AAH91648.1| 597|Homo sapiens kelch-like 21 (Drosophi... 31 7.4 BC084568-1|AAH84568.1| 584|Homo sapiens ZBTB7A protein protein. 31 7.4 BC044840-1|AAH44840.1| 597|Homo sapiens giant axonal neuropathy... 31 7.4 BC034039-1|AAH34039.3| 597|Homo sapiens kelch-like 21 (Drosophi... 31 7.4 AL591866-13|CAI16082.1| 539|Homo sapiens kelch-like 21 (Drosoph... 31 7.4 AL591866-12|CAI16080.1| 597|Homo sapiens kelch-like 21 (Drosoph... 31 7.4 AK127560-1|BAC87035.1| 765|Homo sapiens protein ( Homo sapiens ... 31 7.4 AF291673-1|AAG35311.1| 597|Homo sapiens gigaxonin protein. 31 7.4 AF097916-1|AAC72973.1| 584|Homo sapiens HIV-1 inducer of short ... 31 7.4 AF000561-1|AAB58414.1| 590|Homo sapiens TTF-I interacting pepti... 31 7.4 AB007938-1|BAA32314.2| 559|Homo sapiens KIAA0469 protein protein. 31 7.4 BC063290-1|AAH63290.1| 1066|Homo sapiens zinc finger protein 295... 31 9.8 BC029041-1|AAH29041.1| 668|Homo sapiens ZBTB20 protein protein. 31 9.8 AP001745-3|BAA95529.1| 1066|Homo sapiens ZNF295 protein. 31 9.8 AK092326-1|BAC03863.1| 512|Homo sapiens protein ( Homo sapiens ... 31 9.8 AF139460-1|AAG28340.2| 741|Homo sapiens BTB/POZ zinc finger pro... 31 9.8 AB041015-1|BAD74064.1| 865|Homo sapiens zinc finger protein sho... 31 9.8 AB041014-1|BAD74063.1| 1066|Homo sapiens zinc finger protein lon... 31 9.8 AB033053-1|BAA86541.1| 1069|Homo sapiens KIAA1227 protein protein. 31 9.8 AB002350-1|BAA20809.2| 721|Homo sapiens KIAA0352 protein. 31 9.8 >BC047071-1|AAH47071.1| 410|Homo sapiens BTB (POZ) domain containing 7 protein. Length = 410 Score = 61.7 bits (143), Expect = 6e-09 Identities = 37/129 (28%), Positives = 58/129 (44%) Query: 96 DRGCEHGRYIRSVVGDWQLPEVVVLCEEMEAGAALRDLLTQAELAREXXXXXXXXXXXXX 155 +R +H + +R ++ W + +V L EE E +AL++L QA LAR Sbjct: 77 NRSADHAKQMRELLSGWDVRDVNALVEEYEGTSALKELSLQASLARPEARTLQKDMADLY 136 Query: 156 XXXCWCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELV 215 DV+LI HRA+LAAR +F+ LL P + ++ A + Sbjct: 137 EYKYCTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAEIIMDINTAGIDMPMFS 196 Query: 216 AGVRMLYSG 224 A + LY+G Sbjct: 197 ALLHYLYTG 205 Score = 32.7 bits (71), Expect = 3.2 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 269 ICVDEKILPRRFAKALLHAAYTDQPNL-VWHTAHS 302 I +DE I+P+++A +LH YTD +L V H + S Sbjct: 313 IILDESIIPKKYATVILHCMYTDVVDLSVLHCSPS 347 >AK001510-1|BAA91730.1| 410|Homo sapiens protein ( Homo sapiens cDNA FLJ10648 fis, clone NT2RP2005804. ). Length = 410 Score = 61.7 bits (143), Expect = 6e-09 Identities = 37/129 (28%), Positives = 58/129 (44%) Query: 96 DRGCEHGRYIRSVVGDWQLPEVVVLCEEMEAGAALRDLLTQAELAREXXXXXXXXXXXXX 155 +R +H + +R ++ W + +V L EE E +AL++L QA LAR Sbjct: 77 NRSADHAKQMRELLSGWDVRDVNALVEEYEGTSALKELSLQASLARPEARTLQKDMADLY 136 Query: 156 XXXCWCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELV 215 DV+LI HRA+LAAR +F+ LL P + ++ A + Sbjct: 137 EYKYCTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAEIIMDINTAGIDMPMFS 196 Query: 216 AGVRMLYSG 224 A + LY+G Sbjct: 197 ALLHYLYTG 205 Score = 32.7 bits (71), Expect = 3.2 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 269 ICVDEKILPRRFAKALLHAAYTDQPNL-VWHTAHS 302 I +DE I+P+++A +LH YTD +L V H + S Sbjct: 313 IILDESIIPKKYATVILHCMYTDVVDLSVLHCSPS 347 >AB040958-1|BAA96049.2| 1135|Homo sapiens KIAA1525 protein protein. Length = 1135 Score = 61.7 bits (143), Expect = 6e-09 Identities = 37/129 (28%), Positives = 58/129 (44%) Query: 96 DRGCEHGRYIRSVVGDWQLPEVVVLCEEMEAGAALRDLLTQAELAREXXXXXXXXXXXXX 155 +R +H + +R ++ W + +V L EE E +AL++L QA LAR Sbjct: 80 NRSADHAKQMRELLSGWDVRDVNALVEEYEGTSALKELSLQASLARPEARTLQKDMADLY 139 Query: 156 XXXCWCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELV 215 DV+LI HRA+LAAR +F+ LL P + ++ A + Sbjct: 140 EYKYCTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAEIIMDINTAGIDMPMFS 199 Query: 216 AGVRMLYSG 224 A + LY+G Sbjct: 200 ALLHYLYTG 208 Score = 54.4 bits (125), Expect = 9e-07 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Query: 292 QPNLVWHTAHSASRRGTRRRELGDAALRESVAALVPLVRVEHI-PPDHEVLA 342 +PNL+ TAHS ++RG +RR+L LRE +++L+P VR+EHI P + EVL+ Sbjct: 486 EPNLLSGTAHSVNKRGVKRRDLDMEELREILSSLLPFVRIEHILPINSEVLS 537 Score = 32.7 bits (71), Expect = 3.2 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 269 ICVDEKILPRRFAKALLHAAYTDQPNL-VWHTAHS 302 I +DE I+P+++A +LH YTD +L V H + S Sbjct: 316 IILDESIIPKKYATVILHCMYTDVVDLSVLHCSPS 350 >BC141850-1|AAI41851.1| 410|Homo sapiens BTB (POZ) domain containing 7 protein. Length = 410 Score = 60.9 bits (141), Expect = 1e-08 Identities = 37/129 (28%), Positives = 58/129 (44%) Query: 96 DRGCEHGRYIRSVVGDWQLPEVVVLCEEMEAGAALRDLLTQAELAREXXXXXXXXXXXXX 155 +R +H + +R ++ W + +V L EE E +AL++L QA LAR Sbjct: 77 NRSADHAKQMRELLSGWGVRDVNALVEEYEGTSALKELSLQASLARPEARTLQKDMADLY 136 Query: 156 XXXCWCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELV 215 DV+LI HRA+LAAR +F+ LL P + ++ A + Sbjct: 137 EYKYCTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAEIIMDINTAGIDMPMFS 196 Query: 216 AGVRMLYSG 224 A + LY+G Sbjct: 197 ALLHYLYTG 205 Score = 32.7 bits (71), Expect = 3.2 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 269 ICVDEKILPRRFAKALLHAAYTDQPNL-VWHTAHS 302 I +DE I+P+++A +LH YTD +L V H + S Sbjct: 313 IILDESIIPKKYATVILHCMYTDVVDLSVLHCSPS 347 >AK021953-1|BAB13946.1| 364|Homo sapiens protein ( Homo sapiens cDNA FLJ11891 fis, clone HEMBA1007267. ). Length = 364 Score = 54.4 bits (125), Expect = 9e-07 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Query: 292 QPNLVWHTAHSASRRGTRRRELGDAALRESVAALVPLVRVEHI-PPDHEVLA 342 +PNL+ TAHS ++RG +RR+L LRE +++L+P VR+EHI P + EVL+ Sbjct: 301 EPNLLSGTAHSVNKRGVKRRDLDMEELREILSSLLPFVRIEHILPINSEVLS 352 Score = 32.3 bits (70), Expect = 4.2 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 269 ICVDEKILPRRFAKALLHAAYTDQPNL-VWHTAHS 302 + +DE I+P+++A +LH YTD +L V H + S Sbjct: 131 VILDESIIPKKYATVILHCMYTDVVDLSVLHCSPS 165 >BX538231-1|CAD98074.1| 530|Homo sapiens hypothetical protein protein. Length = 530 Score = 54.0 bits (124), Expect = 1e-06 Identities = 26/52 (50%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Query: 292 QPNLVWHTAHSASRRGTRRRELGDAALRESVAALVPLVRVEHI-PPDHEVLA 342 +PNL+ TAHS ++RG +RR+L LRE +++L+P VR+EHI P + EVL+ Sbjct: 8 EPNLLSGTAHSVNKRGVKRRDLDMEELREILSSLLPFVRIEHILPINTEVLS 59 >BC015649-1|AAH15649.1| 587|Homo sapiens BTB (POZ) domain containing 14A protein. Length = 587 Score = 43.6 bits (98), Expect = 0.002 Identities = 20/42 (47%), Positives = 25/42 (59%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVP 201 +CDV ++ G + AHRAVLAA S YFRDL G +P Sbjct: 29 YCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP 70 >AL591038-1|CAI11059.1| 587|Homo sapiens BTB (POZ) domain containing 14A protein. Length = 587 Score = 43.6 bits (98), Expect = 0.002 Identities = 20/42 (47%), Positives = 25/42 (59%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVP 201 +CDV ++ G + AHRAVLAA S YFRDL G +P Sbjct: 29 YCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP 70 >AL355574-2|CAI14117.1| 587|Homo sapiens BTB (POZ) domain containing 14A protein. Length = 587 Score = 43.6 bits (98), Expect = 0.002 Identities = 20/42 (47%), Positives = 25/42 (59%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVP 201 +CDV ++ G + AHRAVLAA S YFRDL G +P Sbjct: 29 YCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELP 70 >BC055396-1|AAH55396.1| 527|Homo sapiens BTBD14B protein protein. Length = 527 Score = 41.9 bits (94), Expect = 0.005 Identities = 19/42 (45%), Positives = 24/42 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVP 201 +CDV ++ G + AHRAVLAA S YFRDL +P Sbjct: 29 YCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNNSRSAVVELP 70 >AF395817-1|AAK83885.1| 527|Homo sapiens NAC1 protein protein. Length = 527 Score = 41.9 bits (94), Expect = 0.005 Identities = 19/42 (45%), Positives = 24/42 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVP 201 +CDV ++ G + AHRAVLAA S YFRDL +P Sbjct: 29 YCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNNSRSAVVELP 70 >D38496-1|BAA07508.1| 552|Homo sapiens LZTR-1 protein. Length = 552 Score = 39.5 bits (88), Expect = 0.028 Identities = 22/65 (33%), Positives = 34/65 (52%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELVAGVR 219 +CD+ L+ G AH+A+LAARS YF + R P +V + SR+ + +R Sbjct: 378 FCDITLLLDGHPRPAHKAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSRQAFESMLR 437 Query: 220 MLYSG 224 +Y G Sbjct: 438 YIYYG 442 >CT841521-1|CAJ86451.1| 840|Homo sapiens LZTR1 protein. Length = 840 Score = 39.5 bits (88), Expect = 0.028 Identities = 22/65 (33%), Positives = 34/65 (52%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELVAGVR 219 +CD+ L+ G AH+A+LAARS YF + R P +V + SR+ + +R Sbjct: 666 FCDITLLLDGHPRPAHKAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSRQAFESMLR 725 Query: 220 MLYSG 224 +Y G Sbjct: 726 YIYYG 730 >BC026214-1|AAH26214.2| 840|Homo sapiens leucine-zipper-like transcription regulator 1 protein. Length = 840 Score = 39.5 bits (88), Expect = 0.028 Identities = 22/65 (33%), Positives = 34/65 (52%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELVAGVR 219 +CD+ L+ G AH+A+LAARS YF + R P +V + SR+ + +R Sbjct: 666 FCDITLLLDGHPRPAHKAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSRQAFESMLR 725 Query: 220 MLYSG 224 +Y G Sbjct: 726 YIYYG 730 >AK127080-1|BAC86816.1| 799|Homo sapiens protein ( Homo sapiens cDNA FLJ45137 fis, clone BRAWH3038827, highly similar to Homo sapiens leucine-zipper-like transcriptional regulator, 1 (LZTR1). ). Length = 799 Score = 39.5 bits (88), Expect = 0.028 Identities = 22/65 (33%), Positives = 34/65 (52%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPLEGAGASLSREELVAGVR 219 +CD+ L+ G AH+A+LAARS YF + R P +V + SR+ + +R Sbjct: 625 FCDITLLLDGHPRPAHKAILAARSSYFEAMFRSFMPEDGQVNISIGEMVPSRQAFESMLR 684 Query: 220 MLYSG 224 +Y G Sbjct: 685 YIYYG 689 >BX088650-17|CAM26308.1| 473|Homo sapiens zinc finger and BTB domain containing 9 protein. Length = 473 Score = 39.1 bits (87), Expect = 0.037 Identities = 21/37 (56%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRD-LLRGRPP 195 +CDV L+ G L AH+AVLAA S YF D LL G P Sbjct: 47 FCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAP 83 >BC014978-1|AAH14978.1| 473|Homo sapiens zinc finger and BTB domain containing 9 protein. Length = 473 Score = 39.1 bits (87), Expect = 0.037 Identities = 21/37 (56%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRD-LLRGRPP 195 +CDV L+ G L AH+AVLAA S YF D LL G P Sbjct: 47 FCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAP 83 >AL662799-17|CAM25574.1| 473|Homo sapiens zinc finger and BTB domain containing 9 protein. Length = 473 Score = 39.1 bits (87), Expect = 0.037 Identities = 21/37 (56%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRD-LLRGRPP 195 +CDV L+ G L AH+AVLAA S YF D LL G P Sbjct: 47 FCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAP 83 >BC021267-1|AAH21267.1| 388|Homo sapiens KLHL14 protein protein. Length = 388 Score = 38.7 bits (86), Expect = 0.049 Identities = 17/36 (47%), Positives = 20/36 (55%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP 195 +CDV L G H+AVLA+ S YFR L PP Sbjct: 32 FCDVTLTAQGQQFHCHKAVLASCSQYFRSLFSSHPP 67 >AB037805-1|BAA92622.1| 652|Homo sapiens KIAA1384 protein protein. Length = 652 Score = 38.7 bits (86), Expect = 0.049 Identities = 17/36 (47%), Positives = 20/36 (55%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP 195 +CDV L G H+AVLA+ S YFR L PP Sbjct: 56 FCDVTLTAQGQQFHCHKAVLASCSQYFRSLFSSHPP 91 >U69274-1|AAD00172.1| 1053|Homo sapiens zinc finger protein protein. Length = 1053 Score = 36.7 bits (81), Expect = 0.20 Identities = 16/30 (53%), Positives = 21/30 (70%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDL 189 +CDV L+ G AH++VL+A S YFRDL Sbjct: 213 FCDVTLLIEGEEYKAHKSVLSANSEYFRDL 242 >BC111700-1|AAI11701.1| 1053|Homo sapiens zinc finger and BTB domain containing 11 protein. Length = 1053 Score = 36.7 bits (81), Expect = 0.20 Identities = 16/30 (53%), Positives = 21/30 (70%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDL 189 +CDV L+ G AH++VL+A S YFRDL Sbjct: 213 FCDVTLLIEGEEYKAHKSVLSANSEYFRDL 242 >BC131774-1|AAI31775.1| 100|Homo sapiens ZBTB4 protein protein. Length = 100 Score = 35.5 bits (78), Expect = 0.46 Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP 195 +CDV LI AHR+VLAA S +FR+ L P Sbjct: 29 FCDVTLIAGDTKFPAHRSVLAASSPFFREALLTSAP 64 >BC043352-1|AAH43352.1| 1013|Homo sapiens zinc finger and BTB domain containing 4 protein. Length = 1013 Score = 35.5 bits (78), Expect = 0.46 Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP 195 +CDV LI AHR+VLAA S +FR+ L P Sbjct: 29 FCDVTLIAGDTKFPAHRSVLAASSPFFREALLTSAP 64 >AY302699-1|AAP59447.1| 1013|Homo sapiens KAISO-like zinc finger protein 1 protein. Length = 1013 Score = 35.5 bits (78), Expect = 0.46 Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP 195 +CDV LI AHR+VLAA S +FR+ L P Sbjct: 29 FCDVTLIAGDTKFPAHRSVLAASSPFFREALLTSAP 64 >AB040971-1|BAA96062.2| 1029|Homo sapiens KIAA1538 protein protein. Length = 1029 Score = 35.5 bits (78), Expect = 0.46 Identities = 17/36 (47%), Positives = 21/36 (58%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP 195 +CDV LI AHR+VLAA S +FR+ L P Sbjct: 45 FCDVTLIAGDTKFPAHRSVLAASSPFFREALLTSAP 80 >Z97184-1|CAB09990.1| 634|Homo sapiens zinc finger protein 297 protein. Length = 634 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >BX248088-6|CAM25704.1| 149|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 149 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >BX248088-5|CAI41787.2| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >BC018541-1|AAH18541.1| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >AL662827-13|CAM24890.1| 149|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 149 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >AL662827-12|CAI17526.1| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >AL662820-13|CAM25474.1| 149|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 149 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >AL662820-12|CAI18123.1| 634|Homo sapiens zinc finger and BTB domain containing 22 protein. Length = 634 Score = 34.7 bits (76), Expect = 0.80 Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD--LLRG 192 CDV + G AHRAVLAA S YF D LL+G Sbjct: 57 CDVSIRVQGREFRAHRAVLAASSPYFHDQVLLKG 90 >CR450303-1|CAG29299.1| 736|Homo sapiens r 1; complete cds; without stopcodon. protein. Length = 736 Score = 34.3 bits (75), Expect = 1.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPL 202 CDV + G AHR+VLAA S YF + G+ G + L Sbjct: 34 CDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITL 75 >BC063307-1|AAH63307.1| 736|Homo sapiens BTB and CNC homology 1, basic leucine zipper transcription factor 1 protein. Length = 736 Score = 34.3 bits (75), Expect = 1.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPL 202 CDV + G AHR+VLAA S YF + G+ G + L Sbjct: 34 CDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITL 75 >AY346333-1|AAQ24383.1| 305|Homo sapiens double BTB/POZ domain containing protein protein. Length = 305 Score = 34.3 bits (75), Expect = 1.1 Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 159 CWCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 C D+++ G AHRA+L+ARS YF +L G Sbjct: 204 CCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSG 237 >AL163249-6|CAB90435.1| 78|Homo sapiens transcription regulator protein protein. Length = 78 Score = 34.3 bits (75), Expect = 1.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPL 202 CDV + G AHR+VLAA S YF + G+ G + L Sbjct: 34 CDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITL 75 >AF124731-1|AAD14689.1| 736|Homo sapiens BACH1 protein. Length = 736 Score = 34.3 bits (75), Expect = 1.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPL 202 CDV + G AHR+VLAA S YF + G+ G + L Sbjct: 34 CDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITL 75 >AF026199-1|AAB84100.1| 736|Homo sapiens transcription regulator protein protein. Length = 736 Score = 34.3 bits (75), Expect = 1.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPL 202 CDV + G AHR+VLAA S YF + G+ G + L Sbjct: 34 CDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITL 75 >AB002803-1|BAA24932.1| 736|Homo sapiens BACH1 protein. Length = 736 Score = 34.3 bits (75), Expect = 1.1 Identities = 17/42 (40%), Positives = 22/42 (52%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPPGFCRVPL 202 CDV + G AHR+VLAA S YF + G+ G + L Sbjct: 34 CDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGELNITL 75 >BC036468-1|AAH36468.1| 593|Homo sapiens kelch-like 2, Mayven (Drosophila) protein. Length = 593 Score = 33.5 bits (73), Expect = 1.8 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV ++ ++AHR VLAA S YF + G Sbjct: 56 CDVTIVAEDMEISAHRVVLAACSPYFHAMFTG 87 >BC022503-1|AAH22503.1| 593|Homo sapiens kelch-like 2, Mayven (Drosophila) protein. Length = 593 Score = 33.5 bits (73), Expect = 1.8 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV ++ ++AHR VLAA S YF + G Sbjct: 56 CDVTIVAEDMEISAHRVVLAACSPYFHAMFTG 87 >BC012070-1|AAH12070.1| 539|Homo sapiens ZBTB7B protein protein. Length = 539 Score = 33.5 bits (73), Expect = 1.8 Identities = 15/29 (51%), Positives = 18/29 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CD+ + G HRAVLAA SHYF+ L Sbjct: 34 CDLTIRTQGLEYRTHRAVLAACSHYFKKL 62 >AL451085-29|CAI13266.1| 539|Homo sapiens zinc finger and BTB domain containing 7B protein. Length = 539 Score = 33.5 bits (73), Expect = 1.8 Identities = 15/29 (51%), Positives = 18/29 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CD+ + G HRAVLAA SHYF+ L Sbjct: 34 CDLTIRTQGLEYRTHRAVLAACSHYFKKL 62 >AF059569-1|AAC67502.1| 593|Homo sapiens actin binding protein MAYVEN protein. Length = 593 Score = 33.5 bits (73), Expect = 1.8 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV ++ ++AHR VLAA S YF + G Sbjct: 56 CDVTIVAEDMEISAHRVVLAACSPYFHAMFTG 87 >AF007833-1|AAC51847.1| 539|Homo sapiens kruppel-related zinc finger protein hcKrox protein. Length = 539 Score = 33.5 bits (73), Expect = 1.8 Identities = 15/29 (51%), Positives = 18/29 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CD+ + G HRAVLAA SHYF+ L Sbjct: 34 CDLTIRTQGLEYRTHRAVLAACSHYFKKL 62 >BT007194-1|AAP35858.1| 467|Homo sapiens zinc finger protein 297B protein. Length = 467 Score = 33.1 bits (72), Expect = 2.4 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CDV ++ G AH+AVLAA S YF D Sbjct: 33 CDVSIVVQGHIFRAHKAVLAASSPYFCD 60 >BC008828-1|AAH08828.1| 467|Homo sapiens zinc finger and BTB domain containing 43 protein. Length = 467 Score = 33.1 bits (72), Expect = 2.4 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CDV ++ G AH+AVLAA S YF D Sbjct: 33 CDVSIVVQGHIFRAHKAVLAASSPYFCD 60 >AL161731-4|CAI40920.1| 467|Homo sapiens zinc finger and BTB domain containing 43 protein. Length = 467 Score = 33.1 bits (72), Expect = 2.4 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CDV ++ G AH+AVLAA S YF D Sbjct: 33 CDVSIVVQGHIFRAHKAVLAASSPYFCD 60 >AL161731-3|CAI40919.1| 196|Homo sapiens zinc finger and BTB domain containing 43 protein. Length = 196 Score = 33.1 bits (72), Expect = 2.4 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CDV ++ G AH+AVLAA S YF D Sbjct: 33 CDVSIVVQGHIFRAHKAVLAASSPYFCD 60 >AF049907-1|AAC05500.1| 467|Homo sapiens zinc finger transcription factor protein. Length = 467 Score = 33.1 bits (72), Expect = 2.4 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CDV ++ G AH+AVLAA S YF D Sbjct: 33 CDVSIVVQGHIFRAHKAVLAASSPYFCD 60 >AB007874-1|BAA24844.2| 492|Homo sapiens KIAA0414 protein. Length = 492 Score = 33.1 bits (72), Expect = 2.4 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CDV ++ G AH+AVLAA S YF D Sbjct: 58 CDVSIVVQGHIFRAHKAVLAASSPYFCD 85 >BC059404-1|AAH59404.1| 480|Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein) protein. Length = 480 Score = 32.7 bits (71), Expect = 3.2 Identities = 16/32 (50%), Positives = 20/32 (62%) Query: 162 DVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 DV L+ G L AH+AVL A S +F + RGR Sbjct: 39 DVTLLVGGQPLRAHKAVLIACSGFFYSIFRGR 70 >BC013922-1|AAH13922.1| 378|Homo sapiens BTB (POZ) domain containing 8 protein. Length = 378 Score = 32.7 bits (71), Expect = 3.2 Identities = 14/31 (45%), Positives = 20/31 (64%) Query: 162 DVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 D+++ G AHRA+L+ARS YF +L G Sbjct: 207 DIDIFVDGKRFKAHRAILSARSSYFAAMLSG 237 >AL353692-4|CAI16237.1| 841|Homo sapiens BTB and CNC homology 1, basic leucine zipper transcription factor 2 protein. Length = 841 Score = 32.7 bits (71), Expect = 3.2 Identities = 18/33 (54%), Positives = 19/33 (57%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AHRAVLAA S YF L G+ Sbjct: 37 CDVTLIVERKEFRAHRAVLAACSEYFWQALVGQ 69 >AL121787-2|CAI21648.1| 841|Homo sapiens BTB and CNC homology 1, basic leucine zipper transcription factor 2 protein. Length = 841 Score = 32.7 bits (71), Expect = 3.2 Identities = 18/33 (54%), Positives = 19/33 (57%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AHRAVLAA S YF L G+ Sbjct: 37 CDVTLIVERKEFRAHRAVLAACSEYFWQALVGQ 69 >AL121787-1|CAD92600.1| 81|Homo sapiens BTB and CNC homology 1, basic leucine zipper transcription factor 2 protein. Length = 81 Score = 32.7 bits (71), Expect = 3.2 Identities = 18/33 (54%), Positives = 19/33 (57%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AHRAVLAA S YF L G+ Sbjct: 37 CDVTLIVERKEFRAHRAVLAACSEYFWQALVGQ 69 >AJ271878-1|CAC28130.1| 841|Homo sapiens putative transcription factor protein. Length = 841 Score = 32.7 bits (71), Expect = 3.2 Identities = 18/33 (54%), Positives = 19/33 (57%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AHRAVLAA S YF L G+ Sbjct: 37 CDVTLIVERKEFRAHRAVLAACSEYFWQALVGQ 69 >AF357835-1|AAK48898.1| 841|Homo sapiens BACH2 transcription factor protein. Length = 841 Score = 32.7 bits (71), Expect = 3.2 Identities = 18/33 (54%), Positives = 19/33 (57%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AHRAVLAA S YF L G+ Sbjct: 37 CDVTLIVERKEFRAHRAVLAACSEYFWQALVGQ 69 >AB208889-1|BAD92126.1| 857|Homo sapiens BTB and CNC homology 1, basic leucine zipper transcription factor 2 variant protein. Length = 857 Score = 32.7 bits (71), Expect = 3.2 Identities = 18/33 (54%), Positives = 19/33 (57%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AHRAVLAA S YF L G+ Sbjct: 53 CDVTLIVERKEFRAHRAVLAACSEYFWQALVGQ 85 >AB076581-1|BAC00963.1| 480|Homo sapiens BAZF protein. Length = 480 Score = 32.7 bits (71), Expect = 3.2 Identities = 16/32 (50%), Positives = 20/32 (62%) Query: 162 DVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 DV L+ G L AH+AVL A S +F + RGR Sbjct: 39 DVTLLVGGQPLRAHKAVLIACSGFFYSIFRGR 70 >AB076580-1|BAC00962.1| 480|Homo sapiens BAZF protein. Length = 480 Score = 32.7 bits (71), Expect = 3.2 Identities = 16/32 (50%), Positives = 20/32 (62%) Query: 162 DVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 DV L+ G L AH+AVL A S +F + RGR Sbjct: 39 DVTLLVGGQPLRAHKAVLIACSGFFYSIFRGR 70 >CR589949-2|CAM12888.1| 584|Homo sapiens intracisternal A particle-promoted polypeptide protein. Length = 584 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >CR589949-1|CAM12887.1| 582|Homo sapiens intracisternal A particle-promoted polypeptide protein. Length = 582 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >BX664740-2|CAM12889.1| 584|Homo sapiens intracisternal A particle-promoted polypeptide protein. Length = 584 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >BX664740-1|CAI23599.2| 582|Homo sapiens intracisternal A particle-promoted polypeptide protein. Length = 582 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >BC071627-1|AAH71627.1| 470|Homo sapiens KLHL32 protein protein. Length = 470 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >BC032544-1|AAH32544.1| 582|Homo sapiens IPP protein protein. Length = 582 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >BC031830-1|AAH31830.1| 139|Homo sapiens KLHL32 protein protein. Length = 139 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >AL604028-4|CAM12886.1| 584|Homo sapiens intracisternal A particle-promoted polypeptide protein. Length = 584 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >AL604028-3|CAM12885.1| 582|Homo sapiens intracisternal A particle-promoted polypeptide protein. Length = 582 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >AL356958-1|CAI21654.1| 620|Homo sapiens RP1-39B17.1 protein. Length = 620 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >AL033375-2|CAI19824.1| 620|Homo sapiens RP1-39B17.1 protein. Length = 620 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >AL033375-1|CAI19823.1| 139|Homo sapiens RP1-39B17.1 protein. Length = 139 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >AL023656-3|CAI20428.1| 620|Homo sapiens RP1-39B17.1 protein. Length = 620 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >AL023656-2|CAI20427.1| 139|Homo sapiens RP1-39B17.1 protein. Length = 139 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >AK055292-1|BAB70899.1| 620|Homo sapiens protein ( Homo sapiens cDNA FLJ30730 fis, clone FEBRA2000053, weakly similar to Drosophila melanogaster Diablo (dbo) mRNA. ). Length = 620 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 42 CDITLIAEEQKFHAHKAVLAACSDYFR 68 >AF156857-1|AAD39007.1| 584|Homo sapiens actin-binding protein protein. Length = 584 Score = 32.3 bits (70), Expect = 4.2 Identities = 17/33 (51%), Positives = 19/33 (57%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 +CDV+L S AHR VLAA S YF L G Sbjct: 36 FCDVQLQVGQESFKAHRLVLAASSPYFAALFTG 68 >AB067487-1|BAB67793.1| 582|Homo sapiens KIAA1900 protein protein. Length = 582 Score = 32.3 bits (70), Expect = 4.2 Identities = 15/27 (55%), Positives = 17/27 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFR 187 CD+ LI AH+AVLAA S YFR Sbjct: 4 CDITLIAEEQKFHAHKAVLAACSDYFR 30 >DQ227306-1|ABA86591.1| 504|Homo sapiens zinc finger and BTB domain containing 34 protein. Length = 504 Score = 31.9 bits (69), Expect = 5.6 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G AH+AVLAA S YFRD Sbjct: 36 CDIIVHIQGQPFRAHKAVLAASSPYFRD 63 >BX248409-2|CAH73000.1| 609|Homo sapiens kelch-like 20 (Drosophila) protein. Length = 609 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV L+ + AHR +L+A S YFR + G Sbjct: 68 CDVVLVVGAKKIYAHRVILSACSPYFRAMFTG 99 >BC109031-1|AAI09032.1| 644|Homo sapiens kelch-like 34 (Drosophila) protein. Length = 644 Score = 31.9 bits (69), Expect = 5.6 Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLR 191 CDV L G AHR++LA S YFR L + Sbjct: 29 CDVTLETEGSEFPAHRSLLACSSDYFRALFK 59 >BC063418-1|AAH63418.1| 609|Homo sapiens kelch-like 20 (Drosophila) protein. Length = 609 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV L+ + AHR +L+A S YFR + G Sbjct: 68 CDVVLVVGAKKIYAHRVILSACSPYFRAMFTG 99 >BC034470-1|AAH34470.1| 708|Homo sapiens kelch-like 11 (Drosophila) protein. Length = 708 Score = 31.9 bits (69), Expect = 5.6 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Query: 160 WCDVELI--GAGW-SLAAHRAVLAARSHYFRDLLRGR 193 +CD+ L GAG AHR+VLAA + YF LL G+ Sbjct: 93 FCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQ 129 >BC006315-1|AAH06315.1| 361|Homo sapiens zinc finger and BTB domain containing 37 protein. Length = 361 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G + AH+ VLAA S YFRD Sbjct: 32 CDIVVNVQGQAFRAHKVVLAASSPYFRD 59 >BC005253-1|AAH05253.1| 230|Homo sapiens KLHL20 protein protein. Length = 230 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV L+ + AHR +L+A S YFR + G Sbjct: 68 CDVVLVVGAKKIYAHRVILSACSPYFRAMFTG 99 >BC003116-1|AAH03116.1| 361|Homo sapiens zinc finger and BTB domain containing 37 protein. Length = 361 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G + AH+ VLAA S YFRD Sbjct: 32 CDIVVNVQGQAFRAHKVVLAASSPYFRD 59 >AY762229-1|AAW83120.1| 623|Homo sapiens chronic myelogenous leukemia-associated protein protein. Length = 623 Score = 31.9 bits (69), Expect = 5.6 Identities = 16/26 (61%), Positives = 19/26 (73%) Query: 162 DVELIGAGWSLAAHRAVLAARSHYFR 187 D+ L +G L AH+AVLAARS YFR Sbjct: 141 DLVLEVSGRRLRAHKAVLAARSDYFR 166 >AL772392-1|CAI40764.1| 644|Homo sapiens novel protein protein. Length = 644 Score = 31.9 bits (69), Expect = 5.6 Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLR 191 CDV L G AHR++LA S YFR L + Sbjct: 29 CDVTLETEGSEFPAHRSLLACSSDYFRALFK 59 >AL354944-1|CAH69994.1| 504|Homo sapiens zinc finger and BTB domain containing 34 protein. Length = 504 Score = 31.9 bits (69), Expect = 5.6 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G AH+AVLAA S YFRD Sbjct: 36 CDIIVHIQGQPFRAHKAVLAASSPYFRD 63 >AL136170-6|CAI19422.1| 503|Homo sapiens zinc finger and BTB domain containing 37 protein. Length = 503 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G + AH+ VLAA S YFRD Sbjct: 32 CDIVVNVQGQAFRAHKVVLAASSPYFRD 59 >AL136170-5|CAI19421.1| 308|Homo sapiens zinc finger and BTB domain containing 37 protein. Length = 308 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G + AH+ VLAA S YFRD Sbjct: 32 CDIVVNVQGQAFRAHKVVLAASSPYFRD 59 >AL136170-4|CAI19420.1| 361|Homo sapiens zinc finger and BTB domain containing 37 protein. Length = 361 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G + AH+ VLAA S YFRD Sbjct: 32 CDIVVNVQGQAFRAHKVVLAASSPYFRD 59 >AL109921-1|CAI20377.1| 609|Homo sapiens kelch-like 20 (Drosophila) protein. Length = 609 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV L+ + AHR +L+A S YFR + G Sbjct: 68 CDVVLVVGAKKIYAHRVILSACSPYFRAMFTG 99 >AK092279-1|BAC03848.1| 644|Homo sapiens protein ( Homo sapiens cDNA FLJ34960 fis, clone NTONG2003515. ). Length = 644 Score = 31.9 bits (69), Expect = 5.6 Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLR 191 CDV L G AHR++LA S YFR L + Sbjct: 29 CDVTLETEGSEFPAHRSLLACSSDYFRALFK 59 >AK057310-1|BAB71422.1| 308|Homo sapiens protein ( Homo sapiens cDNA FLJ32748 fis, clone TESTI2001556, weakly similar to ZINC FINGER PROTEIN 151. ). Length = 308 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G + AH+ VLAA S YFRD Sbjct: 32 CDIVVNVQGQAFRAHKVVLAASSPYFRD 59 >AK001434-1|BAA91689.1| 708|Homo sapiens protein ( Homo sapiens cDNA FLJ10572 fis, clone NT2RP2003125, weakly similar to RING CANAL PROTEIN. ). Length = 708 Score = 31.9 bits (69), Expect = 5.6 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Query: 160 WCDVELI--GAGW-SLAAHRAVLAARSHYFRDLLRGR 193 +CD+ L GAG AHR+VLAA + YF LL G+ Sbjct: 93 FCDITLCFGGAGGREFRAHRSVLAAATEYFTPLLSGQ 129 >AJ844466-1|CAH59617.1| 609|Homo sapiens KLEIP (kelch-like ECT2 interacting protein) protein. Length = 609 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV L+ + AHR +L+A S YFR + G Sbjct: 68 CDVVLVVGAKKIYAHRVILSACSPYFRAMFTG 99 >AB082524-1|BAC02702.1| 532|Homo sapiens KIAA1993 protein protein. Length = 532 Score = 31.9 bits (69), Expect = 5.6 Identities = 15/28 (53%), Positives = 18/28 (64%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRD 188 CD+ + G AH+AVLAA S YFRD Sbjct: 64 CDIIVHIQGQPFRAHKAVLAASSPYFRD 91 >AB026190-1|BAA77027.1| 609|Homo sapiens Kelch motif containing protein protein. Length = 609 Score = 31.9 bits (69), Expect = 5.6 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRG 192 CDV L+ + AHR +L+A S YFR + G Sbjct: 68 CDVVLVVGAKKIYAHRVILSACSPYFRAMFTG 99 >AB018254-1|BAA34431.2| 661|Homo sapiens KIAA0711 protein protein. Length = 661 Score = 31.9 bits (69), Expect = 5.6 Identities = 16/26 (61%), Positives = 19/26 (73%) Query: 162 DVELIGAGWSLAAHRAVLAARSHYFR 187 D+ L +G L AH+AVLAARS YFR Sbjct: 179 DLVLEVSGRRLRAHKAVLAARSDYFR 204 >BC113511-1|AAI13512.1| 584|Homo sapiens zinc finger and BTB domain containing 7A protein. Length = 584 Score = 31.5 bits (68), Expect = 7.4 Identities = 14/29 (48%), Positives = 18/29 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CDV ++ G HR+VLAA S YF+ L Sbjct: 34 CDVVILVEGREFPTHRSVLAACSQYFKKL 62 >BC109087-1|AAI09088.1| 765|Homo sapiens zinc finger protein 509 protein. Length = 765 Score = 31.5 bits (68), Expect = 7.4 Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLR 191 CD L+ G AH+ VLAA S YFR L + Sbjct: 25 CDCMLVVKGVCFKAHKNVLAAFSQYFRSLFQ 55 >BC091648-1|AAH91648.1| 597|Homo sapiens kelch-like 21 (Drosophila) protein. Length = 597 Score = 31.5 bits (68), Expect = 7.4 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 162 DVELIGAGW-SLAAHRAVLAARSHYFRDLLRGR 193 DV L AG AHRAVLAA S YFR + G+ Sbjct: 36 DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQ 68 >BC084568-1|AAH84568.1| 584|Homo sapiens ZBTB7A protein protein. Length = 584 Score = 31.5 bits (68), Expect = 7.4 Identities = 14/29 (48%), Positives = 18/29 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CDV ++ G HR+VLAA S YF+ L Sbjct: 34 CDVVILVEGREFPTHRSVLAACSQYFKKL 62 >BC044840-1|AAH44840.1| 597|Homo sapiens giant axonal neuropathy (gigaxonin) protein. Length = 597 Score = 31.5 bits (68), Expect = 7.4 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP----GFCRVPLEGAGASLSREEL 214 +CD L+ G + + +LAA S Y R L PP ++ LEG + RE L Sbjct: 29 FCDAHLVLDGEEIPVQKNILAAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREIL 87 >BC034039-1|AAH34039.3| 597|Homo sapiens kelch-like 21 (Drosophila) protein. Length = 597 Score = 31.5 bits (68), Expect = 7.4 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 162 DVELIGAGW-SLAAHRAVLAARSHYFRDLLRGR 193 DV L AG AHRAVLAA S YFR + G+ Sbjct: 36 DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQ 68 >AL591866-13|CAI16082.1| 539|Homo sapiens kelch-like 21 (Drosophila) protein. Length = 539 Score = 31.5 bits (68), Expect = 7.4 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 162 DVELIGAGW-SLAAHRAVLAARSHYFRDLLRGR 193 DV L AG AHRAVLAA S YFR + G+ Sbjct: 36 DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQ 68 >AL591866-12|CAI16080.1| 597|Homo sapiens kelch-like 21 (Drosophila) protein. Length = 597 Score = 31.5 bits (68), Expect = 7.4 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 162 DVELIGAGW-SLAAHRAVLAARSHYFRDLLRGR 193 DV L AG AHRAVLAA S YFR + G+ Sbjct: 36 DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQ 68 >AK127560-1|BAC87035.1| 765|Homo sapiens protein ( Homo sapiens cDNA FLJ45653 fis, clone CTONG2011801, moderately similar to Zinc finger protein 91. ). Length = 765 Score = 31.5 bits (68), Expect = 7.4 Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLR 191 CD L+ G AH+ VLAA S YFR L + Sbjct: 25 CDCMLVVKGVCFKAHKNVLAAFSQYFRSLFQ 55 >AF291673-1|AAG35311.1| 597|Homo sapiens gigaxonin protein. Length = 597 Score = 31.5 bits (68), Expect = 7.4 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLLRGRPP----GFCRVPLEGAGASLSREEL 214 +CD L+ G + + +LAA S Y R L PP ++ LEG + RE L Sbjct: 29 FCDAHLVLDGEEIPVQKNILAAASPYIRTKLNYNPPKDDGSTYKIELEGISVMVMREIL 87 >AF097916-1|AAC72973.1| 584|Homo sapiens HIV-1 inducer of short transcripts binding protein protein. Length = 584 Score = 31.5 bits (68), Expect = 7.4 Identities = 14/29 (48%), Positives = 18/29 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CDV ++ G HR+VLAA S YF+ L Sbjct: 34 CDVVILVEGREFPTHRSVLAACSQYFKKL 62 >AF000561-1|AAB58414.1| 590|Homo sapiens TTF-I interacting peptide 21 protein. Length = 590 Score = 31.5 bits (68), Expect = 7.4 Identities = 14/29 (48%), Positives = 18/29 (62%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CDV ++ G HR+VLAA S YF+ L Sbjct: 86 CDVVILVEGREFPTHRSVLAACSQYFKKL 114 >AB007938-1|BAA32314.2| 559|Homo sapiens KIAA0469 protein protein. Length = 559 Score = 31.5 bits (68), Expect = 7.4 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 162 DVELIGAGW-SLAAHRAVLAARSHYFRDLLRGR 193 DV L AG AHRAVLAA S YFR + G+ Sbjct: 56 DVTLEAAGGRDFPAHRAVLAAASPYFRAMFAGQ 88 >BC063290-1|AAH63290.1| 1066|Homo sapiens zinc finger protein 295 protein. Length = 1066 Score = 31.1 bits (67), Expect = 9.8 Identities = 15/33 (45%), Positives = 18/33 (54%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AH+ VLAA S YF+ L + Sbjct: 30 CDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNK 62 >BC029041-1|AAH29041.1| 668|Homo sapiens ZBTB20 protein protein. Length = 668 Score = 31.1 bits (67), Expect = 9.8 Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLL 190 +CDV + G L AHR VLAA S +F+D L Sbjct: 30 FCDVTVRIHGSMLRAHRCVLAAGSPFFQDKL 60 >AP001745-3|BAA95529.1| 1066|Homo sapiens ZNF295 protein. Length = 1066 Score = 31.1 bits (67), Expect = 9.8 Identities = 15/33 (45%), Positives = 18/33 (54%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AH+ VLAA S YF+ L + Sbjct: 30 CDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNK 62 >AK092326-1|BAC03863.1| 512|Homo sapiens protein ( Homo sapiens cDNA FLJ35007 fis, clone OCBBF2012095, weakly similar to ZINC FINGER PROTEIN 151. ). Length = 512 Score = 31.1 bits (67), Expect = 9.8 Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLL 190 +CD +I G AHR +L A S YFR LL Sbjct: 23 FCDCSIIVEGRIFKAHRNILFANSGYFRALL 53 >AF139460-1|AAG28340.2| 741|Homo sapiens BTB/POZ zinc finger protein DPZF protein. Length = 741 Score = 31.1 bits (67), Expect = 9.8 Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 160 WCDVELIGAGWSLAAHRAVLAARSHYFRDLL 190 +CDV + G L AHR VLAA S +F+D L Sbjct: 103 FCDVTVRIHGSMLRAHRCVLAAGSPFFQDKL 133 >AB041015-1|BAD74064.1| 865|Homo sapiens zinc finger protein short form protein. Length = 865 Score = 31.1 bits (67), Expect = 9.8 Identities = 15/33 (45%), Positives = 18/33 (54%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AH+ VLAA S YF+ L + Sbjct: 30 CDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNK 62 >AB041014-1|BAD74063.1| 1066|Homo sapiens zinc finger protein long form protein. Length = 1066 Score = 31.1 bits (67), Expect = 9.8 Identities = 15/33 (45%), Positives = 18/33 (54%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AH+ VLAA S YF+ L + Sbjct: 30 CDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNK 62 >AB033053-1|BAA86541.1| 1069|Homo sapiens KIAA1227 protein protein. Length = 1069 Score = 31.1 bits (67), Expect = 9.8 Identities = 15/33 (45%), Positives = 18/33 (54%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDLLRGR 193 CDV LI AH+ VLAA S YF+ L + Sbjct: 33 CDVLLIVGDQKFRAHKNVLAASSEYFQSLFTNK 65 >AB002350-1|BAA20809.2| 721|Homo sapiens KIAA0352 protein. Length = 721 Score = 31.1 bits (67), Expect = 9.8 Identities = 13/29 (44%), Positives = 19/29 (65%) Query: 161 CDVELIGAGWSLAAHRAVLAARSHYFRDL 189 CDV ++ S AH+AVLA + YF++L Sbjct: 39 CDVTIVVGSRSFPAHKAVLACAAGYFQNL 67 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.320 0.134 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,315,646 Number of Sequences: 224733 Number of extensions: 2621963 Number of successful extensions: 5221 Number of sequences better than 10.0: 124 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 9 Number of HSP's that attempted gapping in prelim test: 5083 Number of HSP's gapped (non-prelim): 144 length of query: 517 length of database: 73,234,838 effective HSP length: 93 effective length of query: 424 effective length of database: 52,334,669 effective search space: 22189899656 effective search space used: 22189899656 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 67 (31.1 bits)
- SilkBase 1999-2023 -