BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001715-TA|BGIBMGA001715-PA|IPR013069|BTB/POZ, IPR000210|BTB (517 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16E9.03c |||DUF1783 family protein|Schizosaccharomyces pombe... 28 2.7 SPAC2C4.17c |||MS ion channel protein 2|Schizosaccharomyces pomb... 27 8.3 >SPBC16E9.03c |||DUF1783 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/52 (25%), Positives = 27/52 (51%) Query: 229 HTCHTGCGTHVDSSASCTFAPFLTALYRNVMGRRTSSNGAICVDEKILPRRF 280 H C +G T +D S+ + ++ R V R+T ++C+ + ++ R+F Sbjct: 32 HNCGSGVKTIMDKSSIFLKNRYPISINRFVQQRKTFCGASVCLHKVLVQRQF 83 >SPAC2C4.17c |||MS ion channel protein 2|Schizosaccharomyces pombe|chr 1|||Manual Length = 840 Score = 26.6 bits (56), Expect = 8.3 Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 96 DRGCEHGRYIRSVVGDWQLPEVVVLCEEMEA 126 DRG +Y+R V WQ+P ++ E ++ Sbjct: 730 DRGHLPAQYLRQSVATWQIPNLISAIEAYDS 760 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.134 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,951,276 Number of Sequences: 5004 Number of extensions: 66939 Number of successful extensions: 108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 106 Number of HSP's gapped (non-prelim): 2 length of query: 517 length of database: 2,362,478 effective HSP length: 76 effective length of query: 441 effective length of database: 1,982,174 effective search space: 874138734 effective search space used: 874138734 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -