BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001711-TA|BGIBMGA001711-PA|IPR013766|Thioredoxin domain, IPR012336|Thioredoxin-like fold (215 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25580.1 68416.m03181 thioredoxin-related contains weak simil... 213 1e-55 At2g18990.1 68415.m02216 expressed protein 211 3e-55 At3g50960.1 68416.m05580 expressed protein 132 2e-31 At5g66410.1 68418.m08376 expressed protein 130 5e-31 At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 46 1e-05 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 46 3e-05 At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29... 45 3e-05 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 44 6e-05 At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29... 44 1e-04 At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-... 41 6e-04 At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 40 0.001 At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-... 38 0.004 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 38 0.005 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 37 0.012 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 36 0.028 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 35 0.036 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 35 0.048 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 35 0.048 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 34 0.084 At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior... 34 0.084 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 33 0.11 At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containi... 33 0.11 At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containi... 33 0.15 At4g22540.2 68417.m03252 oxysterol-binding family protein simila... 33 0.19 At4g22540.1 68417.m03253 oxysterol-binding family protein simila... 33 0.19 At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containi... 33 0.19 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 33 0.19 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 33 0.19 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 31 0.45 At5g14240.1 68418.m01664 expressed protein 31 0.78 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 31 0.78 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 31 0.78 At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 31 0.78 At2g35010.1 68415.m04295 thioredoxin family protein similar to S... 30 1.0 At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thiore... 29 1.8 At5g46070.1 68418.m05665 guanylate-binding family protein contai... 29 2.4 At4g32160.1 68417.m04574 phox (PX) domain-containing protein con... 29 3.2 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 28 5.5 At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa... 28 5.5 At1g12120.1 68414.m01404 expressed protein contains Pfam domain ... 28 5.5 At5g57870.2 68418.m07239 eukaryotic translation initiation facto... 27 7.3 At5g57870.1 68418.m07238 eukaryotic translation initiation facto... 27 7.3 At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa... 27 9.7 >At3g25580.1 68416.m03181 thioredoxin-related contains weak similarity to thioredoxin (Swiss-Prot:O17486) [Echinococcus granulosus] Length = 210 Score = 213 bits (519), Expect = 1e-55 Identities = 101/208 (48%), Positives = 148/208 (71%), Gaps = 8/208 (3%) Query: 4 VDQLLQHVAQNVERQIDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEY 63 +++ + VA+ +E +ID EI L+ L+ DLE +R++R+ +MK A++K+ W++IGHGEY Sbjct: 9 IEKQVLTVAKAMEDKIDDEIASLEKLDEDDLEVLRERRLKQMKKMAEKKKRWMSIGHGEY 68 Query: 64 TEIDGEKEFFAVCNKSQNVVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPF 123 +EI EK+FF+V S+ VVCHFY+ + P CK++D H+ ILAK+HIETRFVK+ E++PF Sbjct: 69 SEIHSEKDFFSVVKSSERVVCHFYRENWP-CKVMDKHMSILAKQHIETRFVKIQAEKSPF 127 Query: 124 LTGRLKIRVIPTLGLVKDNKTKDFIVGFTDLGNRDDFSTDILEWRIARSEAIEYSGDLLV 183 L RLKI V+PTL L+K+ K D++VGF +LG +DDFST+ LE RIAR++ I Y G+ Sbjct: 128 LAERLKIVVLPTLALIKNTKVDDYVVGFNELGGKDDFSTEDLEERIARAQVIHYEGE--- 184 Query: 184 PPSEAKKQKSLHIQSKKTIRGRDESDSD 211 + KQKS Q ++ +R SDSD Sbjct: 185 ---SSLKQKST-TQVRRNVRQSARSDSD 208 >At2g18990.1 68415.m02216 expressed protein Length = 211 Score = 211 bits (515), Expect = 3e-55 Identities = 100/201 (49%), Positives = 144/201 (71%), Gaps = 7/201 (3%) Query: 11 VAQNVERQIDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEK 70 VA+ +E +ID EI L+ L+ DLE +R++R+ +MK A++K+ W+++GHGEY+EI EK Sbjct: 16 VAKAMEDKIDDEIASLEKLDEDDLEVLRERRLKQMKKMAEKKKRWISLGHGEYSEIHSEK 75 Query: 71 EFFAVCNKSQNVVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKI 130 +FF+V S+ VVCHFY+ + P CK++D H+ ILAK+HIETRFVK+ E++PFL RLKI Sbjct: 76 DFFSVVKASERVVCHFYRENWP-CKVMDKHMSILAKQHIETRFVKIQAEKSPFLAERLKI 134 Query: 131 RVIPTLGLVKDNKTKDFIVGFTDLGNRDDFSTDILEWRIARSEAIEYSGDLLVPPSEAKK 190 V+PTL L+K+ K D++VGF +LG +DDFST+ LE RIAR++ I Y G+ S + K Sbjct: 135 VVLPTLALIKNTKVDDYVVGFNELGGKDDFSTEDLEERIARAQVIHYDGE-----SSSLK 189 Query: 191 QKSLHIQSKKTIRGRDESDSD 211 KS Q ++ +R SDSD Sbjct: 190 PKST-TQVRRNVRQSARSDSD 209 >At3g50960.1 68416.m05580 expressed protein Length = 230 Score = 132 bits (319), Expect = 2e-31 Identities = 64/193 (33%), Positives = 112/193 (58%), Gaps = 6/193 (3%) Query: 19 IDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKEFFAVCNK 78 ++ E++ + ++ +LE + RIA +K ++++ + GHGEY E+ E +F + Sbjct: 42 VNEEVDLDELMDDPELERLHADRIAALKREVEKRESFKRQGHGEYREVS-EGDFLGEVTR 100 Query: 79 SQNVVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGL 138 S+ V+CHFY + RCKI+D HLK LA +H++T+F+K+D E APF +L I+ +P + L Sbjct: 101 SEKVICHFYHKEFYRCKIMDKHLKTLAPRHVDTKFIKVDAENAPFFVTKLAIKTLPCVVL 160 Query: 139 VKDNKTKDFIVGFTDLGNRDDFSTDILEWRIARSEAIEYSGDLLVPPSEAKKQKSLHIQS 198 D +VGF DLG +DDF+T+ LE + + + +A+ Q+S+ Sbjct: 161 FSKGVAMDRLVGFQDLGTKDDFTTNKLE-NVLLKKGMLSKKKKEEDDEDAEYQESI---- 215 Query: 199 KKTIRGRDESDSD 211 ++++R + DSD Sbjct: 216 RRSVRSSENLDSD 228 >At5g66410.1 68418.m08376 expressed protein Length = 230 Score = 130 bits (315), Expect = 5e-31 Identities = 58/150 (38%), Positives = 93/150 (62%), Gaps = 1/150 (0%) Query: 17 RQIDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKEFFAVC 76 R ++ E++ + ++ +LE + RIA ++ ++++ + GHGEY E+ E +F Sbjct: 40 RPVNEEVDLDELMDDPELEKLHADRIAALRREVEKREAFKRQGHGEYREVS-EGDFLGEV 98 Query: 77 NKSQNVVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTL 136 +S+ V+CHFY + RCKI+D HLK LA +H++T+F+K+D E APF +L I+ +P + Sbjct: 99 TRSEKVICHFYHKEFYRCKIMDKHLKTLAPRHVDTKFIKMDAENAPFFVTKLAIKTLPCV 158 Query: 137 GLVKDNKTKDFIVGFTDLGNRDDFSTDILE 166 L D +VGF DLG +DDFST LE Sbjct: 159 ILFSKGIAMDRLVGFQDLGAKDDFSTTKLE 188 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 46.4 bits (105), Expect = 1e-05 Identities = 26/108 (24%), Positives = 56/108 (51%), Gaps = 2/108 (1%) Query: 43 AEMKLRAKQKQEWLAIGHG-EYTEIDGEKEFFAVCNKSQNVVCHFYKSDSPRCKIVDMHL 101 A++ L+ + +E L + G E EI ++F + N V HF + +CK + + Sbjct: 576 AQVALKKSRGEEVLNMEFGGEVEEIYSLEQFKSAMNLPGVSVIHFSTASDHQCKQISPFV 635 Query: 102 KILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVKD-NKTKDFI 148 L ++ F+K+D+++ P + +RV+PT+ + K+ ++ K+ + Sbjct: 636 DSLCTRYPSIHFLKVDIDKCPSIGNAENVRVVPTVKIYKNGSRVKEIV 683 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/88 (26%), Positives = 44/88 (50%) Query: 63 YTEIDGEKEFFAVCNKSQNVVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAP 122 +T D ++ A + +V F + P C+ + LAKKH++ F K+DV+ Sbjct: 11 HTVEDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLDVVFFKVDVDELN 70 Query: 123 FLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 + K++ +PT +K+ + K+ +VG Sbjct: 71 TVAEEFKVQAMPTFIFMKEGEIKETVVG 98 >At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 178 Score = 45.2 bits (102), Expect = 3e-05 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 4/100 (4%) Query: 54 EWLAIGHGEYTEIDGEKEFFAVCNKSQN-VVCHFYKSDSPRCKIVDMHLKILAKKHIETR 112 E + + G+ TE+D + + V + VV Y CK++ K L++K+ + Sbjct: 61 ETVNVSVGQVTEVDKDTFWPIVKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDDVV 120 Query: 113 FVKLDV--ERAPFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 F+KLD + P L L IRV+PT ++KDNK + G Sbjct: 121 FLKLDCNPDNRP-LAKELGIRVVPTFKILKDNKVVKEVTG 159 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 44.4 bits (100), Expect = 6e-05 Identities = 33/151 (21%), Positives = 66/151 (43%), Gaps = 6/151 (3%) Query: 4 VDQLLQHVAQNVERQIDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEY 63 + +L+ V N +R I+ + L + E R +R + A++++ A+ GE Sbjct: 215 IGTMLKKVEPNAKR-IEEHRRKYQRLRK-EKELQRAERERRKQQEAQEREAQAALNDGEV 272 Query: 64 TEIDGEKEFFAVCNKSQN----VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVE 119 I E A ++ ++ +F + C+ + LA +H F+K+D++ Sbjct: 273 ISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHSRVVFLKVDID 332 Query: 120 RAPFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 +A + I +PT ++D K D +VG Sbjct: 333 KANDVAASWNISSVPTFCFIRDGKEVDKVVG 363 >At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450 Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum sativum}; contains Pfam profile: PF00085 Thioredoxin Length = 185 Score = 43.6 bits (98), Expect = 1e-04 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 6/94 (6%) Query: 61 GEYTEIDGEKEFFAVCNKSQN--VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDV 118 G+ TE+D + F+ + + + VV Y CK++ K L++K+ + F+KLD Sbjct: 78 GQVTEVDKDT-FWPIVKAAGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQDMVFLKLDC 136 Query: 119 --ERAPFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 + P L L IRV+PT ++KDNK + G Sbjct: 137 NQDNKP-LAKELGIRVVPTFKILKDNKVVKEVTG 169 >At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1) nearly identical to SP|O48737 Thioredoxin M-type 1, chloroplast precursor (TRX-M1) {Arabidopsis thaliana}; similar to ESTs gb|T13714, gb|H76398, gb|N37762, gb|AA042639, gb|T21104, emb|Z30901 Length = 179 Score = 41.1 bits (92), Expect = 6e-04 Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 4/72 (5%) Query: 94 CKIVDMHLKILAKKHI-ETRFVKLDVERAPFLTGRLKIRVIPTLGLVKDNKTKDFIVGFT 152 CK++D + LA+K+ + +F KL+ + +P G+ +R IPT+ + + + KD I+G Sbjct: 107 CKMIDPIVNELAQKYAGQFKFYKLNTDESPATPGQYGVRSIPTIMIFVNGEKKDTIIGAV 166 Query: 153 DLGNRDDFSTDI 164 ++D +T I Sbjct: 167 ---SKDTLATSI 175 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/79 (27%), Positives = 39/79 (49%) Query: 72 FFAVCNKSQNVVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIR 131 F + ++ +V F S C++++ + +A K + FVKLDV+ P + + Sbjct: 40 FNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFVKLDVDELPDVAKEFNVT 99 Query: 132 VIPTLGLVKDNKTKDFIVG 150 +PT LVK K + I+G Sbjct: 100 AMPTFVLVKRGKEIERIIG 118 >At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2) nearly identical to SP|Q9SEU8 Thioredoxin M-type 2, chloroplast precursor (TRX-M2) {Arabidopsis thaliana} Length = 186 Score = 38.3 bits (85), Expect = 0.004 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 1/70 (1%) Query: 82 VVCHFYKSDSPRCKIVDMHLKILAKKHI-ETRFVKLDVERAPFLTGRLKIRVIPTLGLVK 140 VV F+ CK++D + LA+ + + +F KL+ + +P G+ +R IPT+ + Sbjct: 101 VVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNTPGQYGVRSIPTIMIFV 160 Query: 141 DNKTKDFIVG 150 + KD I+G Sbjct: 161 GGEKKDTIIG 170 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 37.9 bits (84), Expect = 0.005 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Query: 77 NKSQN-VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPT 135 N+S+ +V F S P C+ + +AKK F K+DV+ + K+ +PT Sbjct: 24 NESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTNVVFFKIDVDELQAVAQEFKVEAMPT 83 Query: 136 LGLVKDNKTKDFIVG 150 +K+ D +VG Sbjct: 84 FVFMKEGNIIDRVVG 98 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 36.7 bits (81), Expect = 0.012 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 2/122 (1%) Query: 30 ESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKEFFAVCNKSQNVVCHFYKS 89 +S L A R+ RIA A + Q+ A E + + V V+ F+ Sbjct: 56 QSASLGANRRTRIARGGRIACEAQDTTAAAV-EVPNLSDSEWQTKVLESDVPVLVEFWAP 114 Query: 90 DSPRCKIVDMHLKILAKKHI-ETRFVKLDVERAPFLTGRLKIRVIPTLGLVKDNKTKDFI 148 C+++ + LAK + +F K++ + +P R IR +PT+ + K + KD I Sbjct: 115 WCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKDSI 174 Query: 149 VG 150 +G Sbjct: 175 IG 176 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 35.5 bits (78), Expect = 0.028 Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 94 CKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 CK ++ L+ LA K+ + FVK+DV+ + + +P + +K + D +VG Sbjct: 74 CKTLEPKLEELAAKYTDVEFVKIDVDVLMSVWMEFNLSTLPAIVFMKRGREVDMVVG 130 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 35.1 bits (77), Expect = 0.036 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 5/86 (5%) Query: 82 VVCHFYKSDSPRCKIVDMHLKILAKKHIETR-FVKLDVERAPFLTGRLKIRVIPTLGLVK 140 +V F S P C+++ LAKK + + F K+DV+ + + +PT +K Sbjct: 31 IVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIK 90 Query: 141 DNKTKDFIVGFTDLGNRDDFSTDILE 166 + D +VG N++D I++ Sbjct: 91 AGEVVDKLVG----ANKEDLQAKIVK 112 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 34.7 bits (76), Expect = 0.048 Identities = 21/90 (23%), Positives = 38/90 (42%) Query: 61 GEYTEIDGEKEFFAVCNKSQNVVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVER 120 G +I ++E + + +V HF+ S K +D LA F +++ E Sbjct: 3 GTVKDIVSKEELDNLRHSGAPLVLHFWASWCDASKQMDQVFSHLATDFPRAHFFRVEAEE 62 Query: 121 APFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 P ++ + ++P KD KT D + G Sbjct: 63 HPEISEAYSVALVPYFVFFKDGKTVDTLEG 92 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 34.7 bits (76), Expect = 0.048 Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 94 CKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 CK ++ ++ +A K+ E F ++DV+R + G + +P VK + D +VG Sbjct: 58 CKAMEPRVREIASKYSEAVFARVDVDRLMDVAGTYRAITLPAFVFVKRGEEIDRVVG 114 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 33.9 bits (74), Expect = 0.084 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Query: 77 NKSQN-VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPT 135 N+S+ VV F S C+ + LAKK F+K+D + + I+ +PT Sbjct: 25 NESKTLVVVDFTASWCGPCRFIAPFFADLAKKLPNVLFLKVDTDELKSVASDWAIQAMPT 84 Query: 136 LGLVKDNKTKDFIVG 150 +K+ K D +VG Sbjct: 85 FMFLKEGKILDKVVG 99 >At1g50320.1 68414.m05641 thioredoxin x nearly identical to thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis thaliana] Length = 182 Score = 33.9 bits (74), Expect = 0.084 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 3/123 (2%) Query: 23 IERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKEFFA-VCNKSQN 81 ++ L +++ + A R R +K I G EI GE EF + V +Q Sbjct: 31 VKPLSSVQVTSVAANRHLLSLSSGARRTRKSSSSVIRCGGIKEI-GESEFSSTVLESAQP 89 Query: 82 VVCHFYKSDSPRCKIVDMHLKILAKKHIET-RFVKLDVERAPFLTGRLKIRVIPTLGLVK 140 V+ F + CK++ ++ L++++ + VK+D + P L K+ +P L K Sbjct: 90 VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFILFK 149 Query: 141 DNK 143 D K Sbjct: 150 DGK 152 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 33.5 bits (73), Expect = 0.11 Identities = 16/57 (28%), Positives = 28/57 (49%) Query: 94 CKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 CK ++ + LA ++ FV +DVE + + PT+ +KD + D +VG Sbjct: 23 CKKIEPVFRDLASRYPSMIFVTVDVEELAEFSNEWNVEATPTVVFLKDGRQMDKLVG 79 >At2g42580.1 68415.m05269 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 691 Score = 33.5 bits (73), Expect = 0.11 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Query: 83 VCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVKD- 141 V HF S + +C+ + + L ++ F +DVE + L IR +PT + K+ Sbjct: 609 VFHFKSSSNRQCEEISPFINTLCLRYPLVHFFMVDVEESMALAKAESIRKVPTFKMYKNG 668 Query: 142 NKTKDFI 148 +K K+ + Sbjct: 669 DKVKEMV 675 >At3g14950.1 68416.m01891 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 721 Score = 33.1 bits (72), Expect = 0.15 Identities = 12/52 (23%), Positives = 28/52 (53%) Query: 89 SDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVK 140 + P+CK + + L ++ F+K+++ + P + ++RV+PT + K Sbjct: 645 ASDPQCKEISTFVDALCVRYPSLHFLKVEIVKCPEVGNAERVRVVPTFKIYK 696 >At4g22540.2 68417.m03252 oxysterol-binding family protein similar to SP|P16258 Oxysterol-binding protein 1 {Oryctolagus cuniculus}; contains Pfam profiles PF00169: PH domain, PF01237: Oxysterol-binding protein Length = 510 Score = 32.7 bits (71), Expect = 0.19 Identities = 18/69 (26%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Query: 18 QIDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEI------DGEKE 71 ++ +++ L + L+A+RQ A +++ A K E+ ++G G+Y+E DG++E Sbjct: 19 EMHGQVKLLHEERTNLLDALRQLEAANLEVGASGKHEFSSLGRGKYSECSTTASSDGKQE 78 Query: 72 FFAVCNKSQ 80 F V + + Sbjct: 79 FEDVSEEDE 87 >At4g22540.1 68417.m03253 oxysterol-binding family protein similar to SP|P16258 Oxysterol-binding protein 1 {Oryctolagus cuniculus}; contains Pfam profiles PF00169: PH domain, PF01237: Oxysterol-binding protein Length = 721 Score = 32.7 bits (71), Expect = 0.19 Identities = 18/69 (26%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Query: 18 QIDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEI------DGEKE 71 ++ +++ L + L+A+RQ A +++ A K E+ ++G G+Y+E DG++E Sbjct: 230 EMHGQVKLLHEERTNLLDALRQLEAANLEVGASGKHEFSSLGRGKYSECSTTASSDGKQE 289 Query: 72 FFAVCNKSQ 80 F V + + Sbjct: 290 FEDVSEEDE 298 >At3g58620.1 68416.m06533 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 682 Score = 32.7 bits (71), Expect = 0.19 Identities = 27/118 (22%), Positives = 47/118 (39%), Gaps = 1/118 (0%) Query: 32 GDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKEFFAVCNKSQNVVCHFYKSDS 91 GD E + A L K ++ + E E+ +F + V HF S + Sbjct: 549 GDSEVAESLQRARNALSNKSEEPKYLGFNNEVEEVSTLDKFKTATSLPGISVFHFKSSSN 608 Query: 92 PRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLV-KDNKTKDFI 148 + + + + L ++ F K+DVE + L I+ IPT + K K K+ + Sbjct: 609 RQSEAISPFVNTLCLRYPLVHFFKVDVEESLALAKAESIKKIPTFKIYKKGEKVKEMV 666 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 32.7 bits (71), Expect = 0.19 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query: 77 NKSQNVVCHFYKSDSPRCKIVDMHLKILAKKHIET-RFVKLDVERAPFLTGRLKIRVIPT 135 N + V+ FY + C+++ L +++ + VK+D E+ P L + +I +PT Sbjct: 74 NSDKPVLVDFYATWCGPCQLMVPILNEVSETLKDIIAVVKIDTEKYPSLANKYQIEALPT 133 Query: 136 LGLVKDNKTKDFIVG 150 L KD K D G Sbjct: 134 FILFKDGKLWDRFEG 148 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 32.7 bits (71), Expect = 0.19 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 2/81 (2%) Query: 72 FFAVCNKSQN--VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLK 129 F+ K+QN +V HF ++ + LA + + F+ +DV+ + +L+ Sbjct: 15 FYVSQAKNQNCPIVAHFTALWCIPSVFMNSFFEELAFNYKDALFLIVDVDEVKEVASQLE 74 Query: 130 IRVIPTLGLVKDNKTKDFIVG 150 ++ +PT +KD D +VG Sbjct: 75 VKAMPTFLFLKDGNAMDKLVG 95 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 31.5 bits (68), Expect = 0.45 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query: 77 NKSQNVVCHFYKSDSPRCK-IVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPT 135 N + V+ +Y + C+ +V + ++ + + VK+D E+ P + + KI +PT Sbjct: 79 NSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPT 138 Query: 136 LGLVKDNKTKDFIVG 150 L KD + D G Sbjct: 139 FILFKDGEPCDRFEG 153 >At5g14240.1 68418.m01664 expressed protein Length = 256 Score = 30.7 bits (66), Expect = 0.78 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 14/108 (12%) Query: 16 ERQIDSEIERLDALESGD----LEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKE 71 +++ + E+E L+ + D LE R++R++E++ AK K+ +G T I G Sbjct: 57 DKKTEEELEDLEDDKDLDDDRFLEEYRKKRLSELREAAKVKR------YGTVTPISGSDF 110 Query: 72 FFAVCNKSQN---VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKL 116 V S VVC YK C ++ L L ++ T+FVK+ Sbjct: 111 VREVTQASAEDWVVVC-LYKDGVAECSLLLGCLDELGSRYPATKFVKI 157 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 30.7 bits (66), Expect = 0.78 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 2/74 (2%) Query: 79 SQNVVCHFYKSDSPRCKIVDMHL-KILAKKHIETRFVKLDVERAP-FLTGRLKIRVIPTL 136 SQ ++ + S +C + L K+ A+ + +F +DV + P L R I +PT+ Sbjct: 118 SQPIIIEWMASWCRKCIYLKPKLEKLAAEYNNRAKFYYVDVNKVPQTLVKRGNISKMPTI 177 Query: 137 GLVKDNKTKDFIVG 150 L K+++ K+ ++G Sbjct: 178 QLWKEDEMKEEVIG 191 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 30.7 bits (66), Expect = 0.78 Identities = 19/69 (27%), Positives = 32/69 (46%) Query: 82 VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVKD 141 VV +F + CKIV L++KH F+ +DV+ + I+ PT +K+ Sbjct: 48 VVANFSATWCGPCKIVAPFFIELSEKHSSLMFLLVDVDELSDFSSSWDIKATPTFFFLKN 107 Query: 142 NKTKDFIVG 150 + +VG Sbjct: 108 GQQIGKLVG 116 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 30.7 bits (66), Expect = 0.78 Identities = 34/117 (29%), Positives = 58/117 (49%), Gaps = 8/117 (6%) Query: 20 DSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGE--KEFFAVCN 77 + E++ L+ + LE I Q++ A K RAK+++ L + E T+ +GE ++ V N Sbjct: 61 EQELKALEVRRARALEEIEQKKEAR-KERAKKRK--LGLVDDEDTKTEGETIEDLPKVVN 117 Query: 78 KSQNVVCHFYKSDSPRCKIVDMHLKIL-AKKHIETRFVKLDVERAPFLTGRLKIRVI 133 N FYK ++ D+ L++L A+ + TR D+ER G K V+ Sbjct: 118 VRDNSERAFYKELVKVIELSDVILEVLDARDPLGTRCT--DMERMVMQAGPNKHLVL 172 >At2g35010.1 68415.m04295 thioredoxin family protein similar to SP|Q42443 Thioredoxin H-type (TRX-H) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 194 Score = 30.3 bits (65), Expect = 1.0 Identities = 21/91 (23%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Query: 66 IDGEKEFFAVCNKSQN----VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERA 121 + E+EF +K+Q+ V +F + C+ + + L+K++ + K+D++ Sbjct: 89 VKSEEEFINAMSKAQDGSLPSVFYFTAAWCGPCRFISPVIVELSKQYPDVTTYKVDIDEG 148 Query: 122 PFLT--GRLKIRVIPTLGLVKDNKTKDFIVG 150 +L I +PTL K K +VG Sbjct: 149 GISNTISKLNITAVPTLHFFKGGSKKGEVVG 179 >At1g31020.1 68414.m03798 thioredoxin o (TRXO2) similar to thioredoxin 2 from Saccharomyces cerevisiae GI:173050, 3'-end of protein contains similarity to thioredoxins; contains Pfam profile: PF00085 Thioredoxin; identical to cDNA thioredoxin o (TRXO2) GI:15081458 Length = 159 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/94 (22%), Positives = 43/94 (45%), Gaps = 6/94 (6%) Query: 63 YTEIDGEKEFFAVCNKSQN----VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDV 118 + + E EF + +K+++ V +F + C+++ + L+ K+ + K+D+ Sbjct: 51 FVVLKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPDVTTYKVDI 110 Query: 119 ERAPFLT--GRLKIRVIPTLGLVKDNKTKDFIVG 150 + G+L + +PTL K K IVG Sbjct: 111 DEGGLSNAIGKLNVSAVPTLQFFKGGVKKAEIVG 144 >At5g46070.1 68418.m05665 guanylate-binding family protein contains Pfam domains PF02263: Guanylate-binding protein, N-terminal domain and PF02841: Guanylate-binding protein, C-terminal domain Length = 1060 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Query: 1 MANVDQLLQHVAQNVERQIDSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQ 53 +A +++ + V +N+ERQ + LD L ++EA+ + I E ++ ++K+ Sbjct: 808 LAQIERAERQV-ENLERQKTDLEDELDRLRVSEMEAVSKVTILEARVEEREKE 859 >At4g32160.1 68417.m04574 phox (PX) domain-containing protein contains Pfam profile PF00787: PX domain Length = 723 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/44 (36%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Query: 9 QHVAQNVERQIDSEIERLDALESGDLEAIRQQRI-AEMKLRAKQ 51 Q +N+E+ I SE ER + ++ D+E +RQ+ EMKL++++ Sbjct: 444 QRSKENLEQAIMSERERFNQMQ-WDMEELRQKSYEMEMKLKSRE 486 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 27.9 bits (59), Expect = 5.5 Identities = 14/47 (29%), Positives = 22/47 (46%) Query: 104 LAKKHIETRFVKLDVERAPFLTGRLKIRVIPTLGLVKDNKTKDFIVG 150 LA + FV +DVE + + PT+ +KD + D +VG Sbjct: 87 LASTYTSMIFVTIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVG 133 >At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 273 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/53 (28%), Positives = 26/53 (49%) Query: 82 VVCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLDVERAPFLTGRLKIRVIP 134 VV F+ CK + + +A+K+ E F++++ E L L I V+P Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVEFLQVNYEEHRSLCQSLNIHVLP 168 >At1g12120.1 68414.m01404 expressed protein contains Pfam domain PF05904: Plant protein of unknown function (DUF863) Length = 483 Score = 27.9 bits (59), Expect = 5.5 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 172 SEAIEYSGDLLVPPSEAKKQKSLHIQSKKTIRGRDESDSDDFSD 215 SE I+ + + LV SE Q +QSK +R S+ DF D Sbjct: 308 SEVIQMAAESLVHISEISYQNQ-DLQSKLVLRTNSSSEDQDFPD 350 >At5g57870.2 68418.m07239 eukaryotic translation initiation factor 4F, putative / eIF-4F, putative similar to SP|Q03387 Eukaryotic initiation factor (iso)4F subunit P82-34 (eIF-(iso)4F P82-34) {Triticum aestivum}; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 776 Score = 27.5 bits (58), Expect = 7.3 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 12/116 (10%) Query: 20 DSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKEFFAVCNKS 79 D E ER D + L+ + R+ L+ K E I H E+ G E VC Sbjct: 321 DQEAERNDKEKLLKLKTLGNIRLIGELLKQKMVPE--KIVHHIVQELLGADE--KVCPAE 376 Query: 80 QNV--VCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLD-VERAPFLTGRLKIRV 132 +NV +CHF+K+ K +D ++K +K+ + F +L + + P L RL+ V Sbjct: 377 ENVEAICHFFKTIG---KQLDGNVK--SKRINDVYFKRLQALSKNPQLELRLRFMV 427 >At5g57870.1 68418.m07238 eukaryotic translation initiation factor 4F, putative / eIF-4F, putative similar to SP|Q03387 Eukaryotic initiation factor (iso)4F subunit P82-34 (eIF-(iso)4F P82-34) {Triticum aestivum}; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 780 Score = 27.5 bits (58), Expect = 7.3 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 12/116 (10%) Query: 20 DSEIERLDALESGDLEAIRQQRIAEMKLRAKQKQEWLAIGHGEYTEIDGEKEFFAVCNKS 79 D E ER D + L+ + R+ L+ K E I H E+ G E VC Sbjct: 325 DQEAERNDKEKLLKLKTLGNIRLIGELLKQKMVPE--KIVHHIVQELLGADE--KVCPAE 380 Query: 80 QNV--VCHFYKSDSPRCKIVDMHLKILAKKHIETRFVKLD-VERAPFLTGRLKIRV 132 +NV +CHF+K+ K +D ++K +K+ + F +L + + P L RL+ V Sbjct: 381 ENVEAICHFFKTIG---KQLDGNVK--SKRINDVYFKRLQALSKNPQLELRLRFMV 431 >At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 183 Score = 27.1 bits (57), Expect = 9.7 Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Query: 82 VVCHFYKSDSPRCKIVDMHLKILAKKHIETRF-VKLDVERAPFLTGRLKIRVIPTLGLVK 140 ++ FY + C ++ L++LA ++ VK+D + +++R +PTL + Sbjct: 97 LIVDFYATWCGPCILMAQELEMLAVEYESNAIIVKVDTDDEYEFARDMQVRGLPTLFFIS 156 Query: 141 DNKTKDFI 148 + +KD I Sbjct: 157 PDPSKDAI 164 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,100,633 Number of Sequences: 28952 Number of extensions: 213678 Number of successful extensions: 670 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 633 Number of HSP's gapped (non-prelim): 43 length of query: 215 length of database: 12,070,560 effective HSP length: 78 effective length of query: 137 effective length of database: 9,812,304 effective search space: 1344285648 effective search space used: 1344285648 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -