BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001709-TA|BGIBMGA001709-PA|undefined (622 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 4.7 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 4.7 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.4 bits (48), Expect = 4.7 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Query: 329 RTADSRDPSTDEAWSLEAERLAQDVCAQADLREALVAAGNDGEALSASVEALKAHCRKLE 388 RTA P E + E E AD L+A + E +S +A+ C K E Sbjct: 297 RTAFLGSPEEAETFFRELEAPCPRNYNPADYFIQLLAIVPEKE--ESSRQAVNLICDKFE 354 Query: 389 ADNAVTQAALEQAT 402 N + ALE AT Sbjct: 355 RSNIGVKIALEAAT 368 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 4.7 Identities = 23/74 (31%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Query: 329 RTADSRDPSTDEAWSLEAERLAQDVCAQADLREALVAAGNDGEALSASVEALKAHCRKLE 388 RTA P E + E E AD L+A + E +S +A+ C K E Sbjct: 297 RTAFLGSPEEAETFFRELEAPCPRNYNPADYFIQLLAIVPEKE--ESSRQAVNLICDKFE 354 Query: 389 ADNAVTQAALEQAT 402 N + ALE AT Sbjct: 355 RSNIGVKIALEAAT 368 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.127 0.367 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,190 Number of Sequences: 317 Number of extensions: 3354 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 622 length of database: 114,650 effective HSP length: 61 effective length of query: 561 effective length of database: 95,313 effective search space: 53470593 effective search space used: 53470593 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -