BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001698-TA|BGIBMGA001698-PA|IPR001424|Superoxide dismutase, copper/zinc binding (224 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 3.4 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 3.4 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.2 bits (45), Expect = 3.4 Identities = 6/20 (30%), Positives = 15/20 (75%) Query: 1 MVSDQSCCNKILGVVRLQQT 20 ++S+ C N+++G+ +L Q+ Sbjct: 386 IISNLDCVNEVIGIQQLSQS 405 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 3.4 Identities = 9/35 (25%), Positives = 15/35 (42%) Query: 151 QNPKRICACDGVVVWDERDKPLAGSGRRGQGDRAP 185 Q+ I + + ++ W D G G G G+ P Sbjct: 502 QHYTNIISQEQIISWRSSDDAKGGGGGSGSGNNQP 536 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.138 0.430 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,010 Number of Sequences: 317 Number of extensions: 1300 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 224 length of database: 114,650 effective HSP length: 55 effective length of query: 169 effective length of database: 97,215 effective search space: 16429335 effective search space used: 16429335 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -