BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001697-TA|BGIBMGA001697-PA|undefined (118 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 3.8 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 5.0 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 3.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Query: 34 ELLTPVIAEEDYRELEVLVNFDSSVDDQFLEKTIKTLKTHDGIKEVGFKD 83 ++L VI + E+L + DQ LEK + K IK + KD Sbjct: 403 KILQEVIKFRQKQRAEILAKEHKAAADQKLEKHLIEYKKMLKIKRLFGKD 452 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 20.6 bits (41), Expect = 5.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Query: 60 DQFLEKTIKTLKTHDGI 76 DQ+ +KT T+ +DG+ Sbjct: 71 DQWRDKTFVTILRYDGV 87 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.315 0.137 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,368 Number of Sequences: 429 Number of extensions: 1211 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 118 length of database: 140,377 effective HSP length: 51 effective length of query: 67 effective length of database: 118,498 effective search space: 7939366 effective search space used: 7939366 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.6 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -