BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001697-TA|BGIBMGA001697-PA|undefined (118 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 25 0.15 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 24 0.34 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 1.0 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 1.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 1.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 1.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 1.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 1.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 1.8 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 4.2 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 25.4 bits (53), Expect = 0.15 Identities = 13/43 (30%), Positives = 21/43 (48%) Query: 45 YRELEVLVNFDSSVDDQFLEKTIKTLKTHDGIKEVGFKDGAFV 87 Y+ L L F + ++Q L K + G ++V FK G F+ Sbjct: 325 YKLLSNLGIFPKTTNEQLLRKELLLFAEQMGQRQVAFKVGGFL 367 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 24.2 bits (50), Expect = 0.34 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 39 VIAEEDYRELEVLVNFDSSVDDQFLEKTIKTLK 71 ++A+ D+ E F+ +DQFL KT+K +K Sbjct: 114 LLADYDFSETLTRAKFEELNNDQFL-KTLKPVK 145 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 22.6 bits (46), Expect = 1.0 Identities = 12/37 (32%), Positives = 16/37 (43%) Query: 3 YEKPPVSLDHLQHSEVYKLIHDEEQTPLRRVELLTPV 39 Y VS H Q+ E +++ E P E TPV Sbjct: 364 YYNQDVSCTHYQNPEYISVVNPESPYPQIGSERATPV 400 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 1.8 Identities = 6/13 (46%), Positives = 10/13 (76%) Query: 12 HLQHSEVYKLIHD 24 H++ S +Y L+HD Sbjct: 104 HMEKSAIYNLLHD 116 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 24 DEEQTPLRRVELLTPVIAEEDYRELEVLVNFDSSVD 59 DE+Q+ RRV + + DY E E + FD + + Sbjct: 588 DEDQSA-RRVAQKYLRVVDPDYYEFETHIFFDDAFE 622 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 24 DEEQTPLRRVELLTPVIAEEDYRELEVLVNFDSSVD 59 DE+Q+ RRV + + DY E E + FD + + Sbjct: 588 DEDQSA-RRVAQKYLRVVDPDYYEFETHIFFDDAFE 622 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 24 DEEQTPLRRVELLTPVIAEEDYRELEVLVNFDSSVD 59 DE+Q+ RRV + + DY E E + FD + + Sbjct: 588 DEDQSA-RRVAQKYLRVVDPDYYEFETHIFFDDAFE 622 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 24 DEEQTPLRRVELLTPVIAEEDYRELEVLVNFDSSVD 59 DE+Q+ RRV + + DY E E + FD + + Sbjct: 588 DEDQSA-RRVAQKYLRVVDPDYYEFETHIFFDDAFE 622 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 1.8 Identities = 6/13 (46%), Positives = 10/13 (76%) Query: 12 HLQHSEVYKLIHD 24 H++ S +Y L+HD Sbjct: 104 HMEKSAIYNLLHD 116 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 20.6 bits (41), Expect = 4.2 Identities = 7/24 (29%), Positives = 13/24 (54%) Query: 5 KPPVSLDHLQHSEVYKLIHDEEQT 28 K P S + +QH V + + ++T Sbjct: 86 KAPQSFEDIQHQRVMANVRERQRT 109 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.137 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,388 Number of Sequences: 317 Number of extensions: 1067 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 118 length of database: 114,650 effective HSP length: 50 effective length of query: 68 effective length of database: 98,800 effective search space: 6718400 effective search space used: 6718400 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.1 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -