BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001696-TA|BGIBMGA001696-PA|IPR001478|PDZ/DHR/GLGF (2075 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 26 2.3 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 25 7.2 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 26.2 bits (55), Expect = 2.3 Identities = 32/135 (23%), Positives = 57/135 (42%), Gaps = 13/135 (9%) Query: 468 LLLKTFFIHLTDVMVALSRFILTQPALSKTEERQCA--YRDSINE-TYREDLVSKSKVE- 523 +++ FF HL+DV + ++L L E A D E + L+ K K++ Sbjct: 272 IVMYVFFFHLSDVRYVMVVYLLKNVVLYGLELFILAKIVTDLCQEANSTKKLIVKIKIDI 331 Query: 524 DNRRRENKMV------SQNESKIQEFESKEVKEFDKFEMKESRKSGAKM---AQMSDRRN 574 D N+++ SQNE +I + + F ++K K+ D RN Sbjct: 332 DKEDERNEVISSALKLSQNELEITACKFFSIDNALLFSANSTKKLIVKIRIDIDKEDERN 391 Query: 575 EELTKKMETVITELE 589 E ++ ++ +ELE Sbjct: 392 EIISSALKLSQSELE 406 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 24.6 bits (51), Expect = 7.2 Identities = 12/34 (35%), Positives = 15/34 (44%) Query: 621 PLEWLDKVDSRRASLEKEVTSKQFSSEFKSNAHQ 654 P +WL K RR T SEF +N H+ Sbjct: 323 PFKWLFKKKKRRNRESTTNTQSSSLSEFLTNTHK 356 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.308 0.126 0.333 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 353,646 Number of Sequences: 317 Number of extensions: 13050 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 2 length of query: 2075 length of database: 114,650 effective HSP length: 68 effective length of query: 2007 effective length of database: 93,094 effective search space: 186839658 effective search space used: 186839658 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -