SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001695-TA|BGIBMGA001695-PA|IPR011682|Glycosyl hydrolases
38, C-terminal, IPR011013|Galactose mutarotase-like
         (650 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript...    25   6.3  

>AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1222

 Score = 25.0 bits (52), Expect = 6.3
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 6/62 (9%)

Query: 19  YERILSTAIDDAYSSPDRPSTYD-----RLNRTTTFSKAAQGDSGKAPLFSYDRCHFNES 73
           YER+L + I+D    P+ P   +     R  R+T  +     D+G   + S+ R +  + 
Sbjct: 509 YERLLLSRINDVIEDPESPRLAENQYGFRRGRSTVQAIQLVVDAGSHAM-SFGRTNNRDK 567

Query: 74  RC 75
           RC
Sbjct: 568 RC 569


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.316    0.135    0.398 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 704,356
Number of Sequences: 2123
Number of extensions: 30724
Number of successful extensions: 45
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 45
Number of HSP's gapped (non-prelim): 1
length of query: 650
length of database: 516,269
effective HSP length: 68
effective length of query: 582
effective length of database: 371,905
effective search space: 216448710
effective search space used: 216448710
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 51 (24.6 bits)

- SilkBase 1999-2023 -