BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001694-TA|BGIBMGA001694-PA|undefined (595 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 29 0.46 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 25 4.3 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 24 9.9 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 28.7 bits (61), Expect = 0.46 Identities = 17/61 (27%), Positives = 29/61 (47%) Query: 60 SHSDTDILSANEQKKRKIRKLKLDVKKASQSMTRSLDFTNNDDDGSNAENTPKHKLLDCK 119 S D D S +KRK K + +S ++ D T N++D + + P+ KL++ Sbjct: 506 SDIDDDCRSPRLDRKRKTGTKKRNPSSNDRSPNQNSDSTENNEDLAYLDTLPEVKLVEVT 565 Query: 120 S 120 S Sbjct: 566 S 566 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 25.4 bits (53), Expect = 4.3 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Query: 385 SDSSECNCKCHYSPSDSGL---TSKDTNQSITSSIGNFTMDSNTLSAYSESLDMIVSYNS 441 +DS E + K + SD+ L +S ++N +TS I +D N+L + ++ N+ Sbjct: 240 TDSIEKSAKPTTNTSDAQLELTSSSESNDLVTSIIDTALVDDNSLQETDTTTIPVIPPNA 299 Query: 442 FDDSTLSILQQKTAIERITF 461 D L + + E ++ Sbjct: 300 ADPPPTPALTAQFSPESFSY 319 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 24.2 bits (50), Expect = 9.9 Identities = 10/36 (27%), Positives = 16/36 (44%) Query: 560 CTLCFENLIVGESVLMAHCYDKNHVNRKETLSELFE 595 C C E+ + + + HCYD + V + S E Sbjct: 140 CYCCRESFLRERQLQLTHCYDPDGVRMTDHESATME 175 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.315 0.129 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,747 Number of Sequences: 2123 Number of extensions: 22945 Number of successful extensions: 29 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 27 Number of HSP's gapped (non-prelim): 3 length of query: 595 length of database: 516,269 effective HSP length: 68 effective length of query: 527 effective length of database: 371,905 effective search space: 195993935 effective search space used: 195993935 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -