BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001687-TA|BGIBMGA001687-PA|undefined (91 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 25 0.17 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 20 3.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 19 8.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 19 8.4 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 24.6 bits (51), Expect = 0.17 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 6/67 (8%) Query: 16 PTLPHLKYGMFTKKNVNRSTNAFANYMRQIEELPQAGSDEEF---RYLSDIPRRCEATAQ 72 PT P K T +VN + Y A ++EF Y+S PRRCE AQ Sbjct: 50 PT-PSDKLNTSTTSSVNVNDQNIRRYRTAFTREQLARLEKEFFKENYVSR-PRRCELAAQ 107 Query: 73 TANIPNA 79 N+P + Sbjct: 108 -LNLPES 113 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 20.2 bits (40), Expect = 3.6 Identities = 10/27 (37%), Positives = 12/27 (44%) Query: 10 GGSIPDPTLPHLKYGMFTKKNVNRSTN 36 GGS P + L F K +NR N Sbjct: 165 GGSTRIPKIQQLIKDFFDGKELNRGIN 191 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 19.0 bits (37), Expect = 8.4 Identities = 6/18 (33%), Positives = 12/18 (66%) Query: 28 KKNVNRSTNAFANYMRQI 45 K ++ + NAF YM+++ Sbjct: 476 KPHIKKPLNAFMLYMKEM 493 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 19.0 bits (37), Expect = 8.4 Identities = 6/18 (33%), Positives = 12/18 (66%) Query: 28 KKNVNRSTNAFANYMRQI 45 K ++ + NAF YM+++ Sbjct: 368 KPHIKKPLNAFMLYMKEM 385 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.126 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,359 Number of Sequences: 317 Number of extensions: 814 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 91 length of database: 114,650 effective HSP length: 47 effective length of query: 44 effective length of database: 99,751 effective search space: 4389044 effective search space used: 4389044 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.6 bits) S2: 37 (19.0 bits)
- SilkBase 1999-2023 -