BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001687-TA|BGIBMGA001687-PA|undefined (91 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132860-17|CAB60516.1| 497|Caenorhabditis elegans Hypothetical... 28 0.73 AL132860-16|CAB60499.1| 512|Caenorhabditis elegans Hypothetical... 28 0.73 Z83120-1|CAB05583.1| 837|Caenorhabditis elegans Hypothetical pr... 28 0.97 Z70213-9|CAA94177.1| 1520|Caenorhabditis elegans Hypothetical pr... 26 3.0 Z49069-5|CAA88867.1| 1520|Caenorhabditis elegans Hypothetical pr... 26 3.0 AF016452-17|AAB66021.1| 1152|Caenorhabditis elegans Hypothetical... 26 3.9 AF016419-3|AAG24048.1| 529|Caenorhabditis elegans Hypothetical ... 25 5.2 Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical pr... 25 6.8 AF036706-17|AAK39277.2| 582|Caenorhabditis elegans Enhanced rna... 25 6.8 AL023828-18|CAA19462.2| 742|Caenorhabditis elegans Hypothetical... 25 9.0 AJ132699-1|CAA10735.1| 742|Caenorhabditis elegans centaurin bet... 25 9.0 AF022967-12|AAB69873.2| 467|Caenorhabditis elegans Hypothetical... 25 9.0 AF000197-8|AAB52897.2| 328|Caenorhabditis elegans Star (rna bin... 25 9.0 AF000197-7|AAU20839.1| 445|Caenorhabditis elegans Star (rna bin... 25 9.0 AF000197-6|AAP68907.1| 403|Caenorhabditis elegans Star (rna bin... 25 9.0 >AL132860-17|CAB60516.1| 497|Caenorhabditis elegans Hypothetical protein Y56A3A.17b protein. Length = 497 Score = 28.3 bits (60), Expect = 0.73 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query: 24 GMFTKKNVNRSTNAFANYMRQIEELPQAGS-DEEFRYLSDIPRRCEATAQTANIPNAQSH 82 G FT+KN + +YM + +L Q D++ +PRR E +++++ A Sbjct: 36 GYFTEKNHYDFSGTMKSYMDHVAQLKQIYKVDDDVAADMTVPRRTENSSESSGETVAPRK 95 Query: 83 VASA 86 +A A Sbjct: 96 IAKA 99 >AL132860-16|CAB60499.1| 512|Caenorhabditis elegans Hypothetical protein Y56A3A.17a protein. Length = 512 Score = 28.3 bits (60), Expect = 0.73 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query: 24 GMFTKKNVNRSTNAFANYMRQIEELPQAGS-DEEFRYLSDIPRRCEATAQTANIPNAQSH 82 G FT+KN + +YM + +L Q D++ +PRR E +++++ A Sbjct: 36 GYFTEKNHYDFSGTMKSYMDHVAQLKQIYKVDDDVAADMTVPRRTENSSESSGETVAPRK 95 Query: 83 VASA 86 +A A Sbjct: 96 IAKA 99 >Z83120-1|CAB05583.1| 837|Caenorhabditis elegans Hypothetical protein R06A4.2 protein. Length = 837 Score = 27.9 bits (59), Expect = 0.97 Identities = 16/40 (40%), Positives = 20/40 (50%) Query: 46 EELPQAGSDEEFRYLSDIPRRCEATAQTANIPNAQSHVAS 85 E LP + + + SDIPR E + IPN SH AS Sbjct: 675 ELLPNSCRVKMEKSYSDIPRSAEPVFKVPMIPNRLSHSAS 714 >Z70213-9|CAA94177.1| 1520|Caenorhabditis elegans Hypothetical protein K12D12.1 protein. Length = 1520 Score = 26.2 bits (55), Expect = 3.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 26 FTKKNVNRSTNAFANYMRQIEELPQAGSDEEFRYLSD 62 F+KK + + + +MR+ ++ Q G EE+ Y D Sbjct: 688 FSKKKIEERKDWLSKWMREKKDRKQQGLAEEYLYNKD 724 >Z49069-5|CAA88867.1| 1520|Caenorhabditis elegans Hypothetical protein K12D12.1 protein. Length = 1520 Score = 26.2 bits (55), Expect = 3.0 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 26 FTKKNVNRSTNAFANYMRQIEELPQAGSDEEFRYLSD 62 F+KK + + + +MR+ ++ Q G EE+ Y D Sbjct: 688 FSKKKIEERKDWLSKWMREKKDRKQQGLAEEYLYNKD 724 >AF016452-17|AAB66021.1| 1152|Caenorhabditis elegans Hypothetical protein T05H4.3 protein. Length = 1152 Score = 25.8 bits (54), Expect = 3.9 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Query: 8 VDGGSIPDPTLPHLKYGMFTK-KNVNRSTNAFANYMRQIEELPQAGS-DEEFRYLSDIPR 65 + SI + ++ L + K KN+N S NA + + + +LP S D + I R Sbjct: 911 ISNNSISNTSILRLGIPLLLKLKNINLSQNALSRFDCSLFDLPNLESVDLSNNSIKTIIR 970 Query: 66 RCEATAQTANIPN 78 R T + N+ N Sbjct: 971 RPLKTLTSLNLQN 983 >AF016419-3|AAG24048.1| 529|Caenorhabditis elegans Hypothetical protein F07G11.3 protein. Length = 529 Score = 25.4 bits (53), Expect = 5.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 22 KYGMFTKKNVNRSTNAFANYMRQIEE 47 KYG F + S N F N M++ EE Sbjct: 193 KYGAFVNLYLVSSVNTFYNLMKEYEE 218 >Z75525-2|CAA99763.1| 1390|Caenorhabditis elegans Hypothetical protein C03D6.4 protein. Length = 1390 Score = 25.0 bits (52), Expect = 6.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Query: 4 REASVDGGSIPDPTLPHLKYGM 25 + +SV GGS+ PT+P++ GM Sbjct: 1173 KPSSVFGGSVTAPTVPNVDDGM 1194 >AF036706-17|AAK39277.2| 582|Caenorhabditis elegans Enhanced rnai (rna interference)protein 1, isoform b protein. Length = 582 Score = 25.0 bits (52), Expect = 6.8 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Query: 52 GSDEEFRYLSDIPRRCEATAQTANIPNAQS-HVASAQKL 89 GSD E LS+ P E + + + P+A S HV S+ L Sbjct: 517 GSDSERENLSNAPSLHEFPSSSTSSPHATSEHVTSSSPL 555 >AL023828-18|CAA19462.2| 742|Caenorhabditis elegans Hypothetical protein Y17G7B.15b protein. Length = 742 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 4 REASVDGGSIPDPTLPHLKYGM 25 R++SVD GSI D L K G+ Sbjct: 134 RDSSVDSGSITDKALKDKKRGL 155 >AJ132699-1|CAA10735.1| 742|Caenorhabditis elegans centaurin beta 1B protein. Length = 742 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 4 REASVDGGSIPDPTLPHLKYGM 25 R++SVD GSI D L K G+ Sbjct: 134 RDSSVDSGSITDKALKDKKRGL 155 >AF022967-12|AAB69873.2| 467|Caenorhabditis elegans Hypothetical protein C13A2.1 protein. Length = 467 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Query: 22 KYGMFTKKNVNRSTNAFANYMRQIEELPQA 51 KYG F + + N F N M++ EE A Sbjct: 188 KYGAFVNLYLISAVNTFYNLMKEYEEAEAA 217 >AF000197-8|AAB52897.2| 328|Caenorhabditis elegans Star (rna binding protein) familyprotein 2, isoform a protein. Length = 328 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query: 37 AFANYMRQIEELPQAGSDEEFRYLSDIPRRCEATAQTANIPNAQ 80 AF N +E L +DEE + + +CE + ++A +P+A+ Sbjct: 43 AFPNVFHHLERL----ADEEINKVRVVLFQCEFSKESAPLPDAE 82 >AF000197-7|AAU20839.1| 445|Caenorhabditis elegans Star (rna binding protein) familyprotein 2, isoform c protein. Length = 445 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query: 37 AFANYMRQIEELPQAGSDEEFRYLSDIPRRCEATAQTANIPNAQ 80 AF N +E L +DEE + + +CE + ++A +P+A+ Sbjct: 85 AFPNVFHHLERL----ADEEINKVRVVLFQCEFSKESAPLPDAE 124 >AF000197-6|AAP68907.1| 403|Caenorhabditis elegans Star (rna binding protein) familyprotein 2, isoform b protein. Length = 403 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Query: 37 AFANYMRQIEELPQAGSDEEFRYLSDIPRRCEATAQTANIPNAQ 80 AF N +E L +DEE + + +CE + ++A +P+A+ Sbjct: 43 AFPNVFHHLERL----ADEEINKVRVVLFQCEFSKESAPLPDAE 82 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.312 0.126 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,280,548 Number of Sequences: 27539 Number of extensions: 81557 Number of successful extensions: 154 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 146 Number of HSP's gapped (non-prelim): 15 length of query: 91 length of database: 12,573,161 effective HSP length: 69 effective length of query: 22 effective length of database: 10,672,970 effective search space: 234805340 effective search space used: 234805340 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -