BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001686-TA|BGIBMGA001686-PA|undefined (359 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 36 0.032 At5g24880.1 68418.m02946 expressed protein ; expression supporte... 33 0.22 At3g26390.1 68416.m03291 hypothetical protein 32 0.51 At1g62010.1 68414.m06994 mitochondrial transcription termination... 31 1.2 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 31 1.2 At4g28715.1 68417.m04107 myosin heavy chain, putative similar to... 31 1.6 At4g27595.1 68417.m03964 protein transport protein-related low s... 31 1.6 At4g30400.1 68417.m04318 zinc finger (C3HC4-type RING finger) fa... 30 2.1 At5g65460.1 68418.m08232 kinesin motor protein-related contains ... 30 2.7 At5g61570.1 68418.m07726 protein kinase family protein contains ... 30 2.7 At5g04640.1 68418.m00470 MADS-box family protein SLM3 MADS-box p... 30 2.7 At4g30720.1 68417.m04354 expressed protein hypothetical protein ... 30 2.7 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 30 2.7 At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10... 30 2.7 At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10... 30 2.7 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 29 3.6 At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contai... 29 3.6 At1g03080.1 68414.m00282 kinase interacting family protein simil... 29 3.6 At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative s... 29 4.8 At1g11710.1 68414.m01344 pentatricopeptide (PPR) repeat-containi... 29 4.8 At5g17930.1 68418.m02102 MA3 domain-containing protein low simil... 29 6.3 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 29 6.3 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 29 6.3 At1g63300.1 68414.m07156 expressed protein similar to Intracellu... 29 6.3 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 28 8.4 At3g22860.1 68416.m02882 eukaryotic translation initiation facto... 28 8.4 At2g38720.1 68415.m04755 microtubule associated protein (MAP65/A... 28 8.4 At1g57780.1 68414.m06556 heavy-metal-associated domain-containin... 28 8.4 At1g06950.1 68414.m00738 chloroplast inner envelope protein-rela... 28 8.4 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 36.3 bits (80), Expect = 0.032 Identities = 47/207 (22%), Positives = 101/207 (48%), Gaps = 26/207 (12%) Query: 31 DNFKDTECTILRDEITSKRNVALEVCDTLYVGAEEQEELGKTIIMARNKKTGKVRIIEVG 90 DN +D E L++E ++ A E+ + Y+ A++ E KT R ++ V+++E G Sbjct: 2203 DNLQD-EVLNLKEEFGKMKSEAKEM-EARYIEAQQIAESRKTYADEREEE---VKLLE-G 2256 Query: 91 TVDLKPYLKVDLDNSQLMETSNLDLSRKFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQ 150 +V+ Y L+N + + R QRE+L++ + T+ QM++ ++ Sbjct: 2257 SVEELEYTINVLENKVNVVKDEAERQRL-----------QREELEMELHTIRQQMES-AR 2304 Query: 151 NISEDQ---LDLSNYNKTDENFYVPPIDREAKSVEQVYDLDKILTEDMFE-KVYEEMENT 206 N E+ LD + + ++ ++R + +Q ++ + L+E + E ++ E + + Sbjct: 2305 NADEEMKRILDEKHMDLAQAKKHIEALER--NTADQKTEITQ-LSEHISELNLHAEAQAS 2361 Query: 207 DYMSNFNEFLKTIVSENMPKKHLVLAL 233 +YM F E L+ + + P+ H+ A+ Sbjct: 2362 EYMHKFKE-LEAMAEQVKPEIHVSQAI 2387 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/83 (25%), Positives = 44/83 (53%), Gaps = 3/83 (3%) Query: 125 KKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDREAKSVEQV 184 +K+++ + ++ + + +Q N + N SE++ D+ K DEN +D E+K VE V Sbjct: 272 EKLIKNEDDIEEKTEEMKEQDNNQA-NKSEEEEDVKK--KIDENETPEKVDTESKEVESV 328 Query: 185 YDLDKILTEDMFEKVYEEMENTD 207 + + E++ E+ E +E + Sbjct: 329 EETTQEKEEEVKEEGKERVEEEE 351 >At3g26390.1 68416.m03291 hypothetical protein Length = 166 Score = 32.3 bits (70), Expect = 0.51 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 3/71 (4%) Query: 123 KHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNY---NKTDENFYVPPIDREAK 179 K +++M + K K+N TD + V S+D+ L Y K Y P +R+ Sbjct: 10 KKRRLMISKGKRKINEDETTDLIVRVGAFASDDKTLLKRYEGFKKYVVVLYTDPEERDQT 69 Query: 180 SVEQVYDLDKI 190 V +VY DK+ Sbjct: 70 QVIKVYHGDKL 80 >At1g62010.1 68414.m06994 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 415 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/62 (27%), Positives = 31/62 (50%) Query: 176 REAKSVEQVYDLDKILTEDMFEKVYEEMENTDYMSNFNEFLKTIVSENMPKKHLVLALYA 235 RE KS+ + YD K++ E YE++ ++ N + + +P+K L+L L + Sbjct: 137 REGKSLSRYYDFIKVIIEADKSSKYEKISHSLAQGNKIRNILVLRELGVPQKRLLLLLIS 196 Query: 236 NS 237 S Sbjct: 197 KS 198 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 31.1 bits (67), Expect = 1.2 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%) Query: 99 KVDLDNSQLMETSNLDLSRKFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLD 158 K L+N TSNL+L ++ + + ++ E L+ + + Q+++ + S++ D Sbjct: 890 KTKLENQVEELTSNLELEKQMRMEIEEAKSQEIEALQSVLTDIKLQLRDTQETKSKEISD 949 Query: 159 LSNYNKTDENFYVPPIDREAKSVEQVYDLDKILTEDM---FEKVYEEMENTDYMSNFNEF 215 L + TD + +E KS +++ DL L +DM E++ + +E T+ ++ NE Sbjct: 950 LQSV-LTDIKLQLRD-TQETKS-KEISDLQSAL-QDMQLEIEELSKGLEMTNDLAAENEQ 1005 Query: 216 LKTIVS 221 LK VS Sbjct: 1006 LKESVS 1011 >At4g28715.1 68417.m04107 myosin heavy chain, putative similar to myosin [Arabidopsis thaliana] gi|499047|emb|CAA84066 Length = 639 Score = 30.7 bits (66), Expect = 1.6 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 6/128 (4%) Query: 43 DEITSKRNVALE-VCDTLYVGAEEQEELGKTIIMARNKKTGKVRII-EVGTVDLKPYLKV 100 +E ++ N L + + + +E + L + A K V ++ EV VD + K+ Sbjct: 45 EESKTQENAKLRSALEEMQLQFKETKALHLQEVEAAKKMAETVPVLQEVPVVDTELVEKL 104 Query: 101 DLDNSQLME-TSNLDLSRKFGSKKHK---KIMEQREKLKVNVQTVTDQMQNVSQNISEDQ 156 +N +L S+LD KK + KI E+R K + +T ++ + E Sbjct: 105 TSENEKLKSLVSSLDQKIDETEKKFEERSKINEERLKQAIEAETTIVNLKTAVHELQEKI 164 Query: 157 LDLSNYNK 164 LD+ + NK Sbjct: 165 LDVESENK 172 >At4g27595.1 68417.m03964 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 1212 Score = 30.7 bits (66), Expect = 1.6 Identities = 34/164 (20%), Positives = 76/164 (46%), Gaps = 12/164 (7%) Query: 43 DEITSKRNVALEVCDTLYVGAEEQEELGKTIIMARNKKTGKVRIIEVGTVDLKPYLKVDL 102 +E+++ + +E L +E EEL + + A KK ++ + VD + L+ + Sbjct: 685 EELSAAKESLVEKETKLLSTVQEAEELRRREL-ACLKKIEELSAVNERLVDKETKLQSSI 743 Query: 103 DNSQLMETSNLDLSRKFG--SKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLS 160 ++++ + ++ S +++++E+ KL QTV + + + + S Q + Sbjct: 744 QEVEVLKEREAENIKQIEELSLSNERLVEKEAKL----QTVVQENEELREKESAYQKKIE 799 Query: 161 NYNKTDENFYVPPIDREAKSVEQVYDLDKILTEDM-FEKVYEEM 203 +K DE F DREAK + +++ ++ + K EE+ Sbjct: 800 ELSKVDEIF----ADREAKLQSSTQENEELREREVAYLKKIEEL 839 >At4g30400.1 68417.m04318 zinc finger (C3HC4-type RING finger) family protein similar to RING-H2 finger protein RHX1a [Arabidopsis thaliana] GI:3790591; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 472 Score = 30.3 bits (65), Expect = 2.1 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 10/82 (12%) Query: 68 ELGKTI--IMARNKKTGKVRIIEVGTVDLKPYLKVDLDNSQLMETSNLDLSRKFGSKKHK 125 ELG ++ ++ + K GK R I++G + N+ + +S+LD R F ++ Sbjct: 256 ELGGSVGKVVPFSVKLGKFRNIDIG--------EGTSSNNNIGNSSSLDERRCFSMGSYE 307 Query: 126 KIMEQREKLKVNVQTVTDQMQN 147 IM++ LKV+V T +N Sbjct: 308 YIMDEETTLKVHVSTKKQSSKN 329 >At5g65460.1 68418.m08232 kinesin motor protein-related contains similarity to kinesin heavy chain Length = 1281 Score = 29.9 bits (64), Expect = 2.7 Identities = 25/115 (21%), Positives = 50/115 (43%), Gaps = 10/115 (8%) Query: 93 DLKPYLKVDLDNSQLMETSNLDLSRKFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNI 152 DLK + +D ++ + N L + +EQ +KL+ Q T +QN+ + Sbjct: 541 DLKSENAMVVDKHKIEKEQNFQLRNQIAQLLQ---LEQEQKLQAQQQDST--IQNLQSKV 595 Query: 153 SEDQLDLSNYNKTDENFYVPPIDREAKSVEQVYDLDKILTEDMFEKVYEEMENTD 207 + + LS K+D P++ + ++ E D + +K+ EE++ D Sbjct: 596 KDLESQLSKALKSDMTRSRDPLEPQPRAAENTLDSSAVT-----KKLEEELKKRD 645 >At5g61570.1 68418.m07726 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 361 Score = 29.9 bits (64), Expect = 2.7 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 7/99 (7%) Query: 10 CPKDETERHPVIFNFQNGYITDNFKDTECTILRDEITSKRNVALEVCDTLYVGAE--EQE 67 C + TE + V ++ ++ Y F D + I L +CD L E + Sbjct: 32 CRRTTTETNEVQYDVESPYEKQEFSDNGSETEEELIIFNGGEDLTICDILDAPGEVIGKS 91 Query: 68 ELGKTIIMARNKKTGKVRIIEVGTVDLKPYLKVDLDNSQ 106 G T+ A +++GKVR++ L+P V+ D+ + Sbjct: 92 SYG-TLYKATLQRSGKVRVLRF----LRPLCAVNSDSKE 125 >At5g04640.1 68418.m00470 MADS-box family protein SLM3 MADS-box protein, S.latifolia, EMBL:SLSLM3 Length = 322 Score = 29.9 bits (64), Expect = 2.7 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 5/77 (6%) Query: 139 QTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPP----IDREAKSVEQVYDLDKILT-E 193 +TV D+ V +N+ ED + +S+ + D + + +Q DLD++L E Sbjct: 204 ETVEDRELVVHKNMDEDNIHVSDMDDKDTMLMISDKNNVLPENLDEFDQELDLDQLLDFE 263 Query: 194 DMFEKVYEEMENTDYMS 210 +E + + E DY S Sbjct: 264 TNYESLLKSCEMEDYAS 280 >At4g30720.1 68417.m04354 expressed protein hypothetical protein - Synechocystis sp. (strain PCC 6803),PIR2:S76076 Length = 749 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/43 (32%), Positives = 24/43 (55%) Query: 118 KFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLS 160 KFG++ ++E + V V T+Q+Q SQN+ D + L+ Sbjct: 397 KFGTRVDDLLVEDSRVVGVRVSDSTNQLQTTSQNLKVDAVVLA 439 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/91 (23%), Positives = 43/91 (47%), Gaps = 4/91 (4%) Query: 103 DNSQLMETSNLDLSR-KFGSKKHKKIMEQ---REKLKVNVQTVTDQMQNVSQNISEDQLD 158 DN + + S+ D+ + K + K K I + ++ + + + DQ ++ Q++ E+Q Sbjct: 158 DNEEAVTKSDSDVDQQKAKNVKGKNIGQDGDIKQDARDQEEKINDQEDSIKQDVDEEQNK 217 Query: 159 LSNYNKTDENFYVPPIDREAKSVEQVYDLDK 189 +S K EN V + + +Q D+ K Sbjct: 218 ISGIEKVVENQEVKIMCEQKHGTKQDEDVTK 248 >At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 29.9 bits (64), Expect = 2.7 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 7/99 (7%) Query: 118 KFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDRE 177 KF HK +EQ N++ D++ N N E + LS + K D+N Y I E Sbjct: 20 KFKETVHK--LEQESGFFFNMKYFEDEVHN--GNWDEVEKYLSGFTKVDDNRYSMKIFFE 75 Query: 178 AKSVEQVYDLDKILTEDMFEKVYEEMENTDYMSNFNEFL 216 + + + LDK D + V +++ S FNE L Sbjct: 76 IRKQKYLEALDK---HDRPKAVDILVKDLKVFSTFNEEL 111 >At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 29.9 bits (64), Expect = 2.7 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 7/99 (7%) Query: 118 KFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDRE 177 KF HK +EQ N++ D++ N N E + LS + K D+N Y I E Sbjct: 20 KFKETVHK--LEQESGFFFNMKYFEDEVHN--GNWDEVEKYLSGFTKVDDNRYSMKIFFE 75 Query: 178 AKSVEQVYDLDKILTEDMFEKVYEEMENTDYMSNFNEFL 216 + + + LDK D + V +++ S FNE L Sbjct: 76 IRKQKYLEALDK---HDRPKAVDILVKDLKVFSTFNEEL 111 >At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) identical to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 355 Score = 29.5 bits (63), Expect = 3.6 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Query: 123 KHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDREAKSVE 182 +++KI+E+++K +Q++T + V + E LSN DE F D++ + + Sbjct: 230 EYEKILEEKKKA---LQSLTTSERKVDTKVFESMQQLSNKKSNDEIFIKLGSDKDKRKDD 286 Query: 183 QVYDLDKILTEDMFEKVYE 201 + K ++ + F K E Sbjct: 287 KEEKAKKAVSINEFLKPAE 305 >At3g06980.1 68416.m00829 DEAD/DEAH box helicase, putative contains Pfam profile: PF00270 DEAD/DEAH box helicase Length = 781 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query: 132 EKLKVNVQTVTDQMQNVSQNISEDQLDLSNYN-KTDENF 169 +K+K V VT + Q++S N ED+ D S+ N DE F Sbjct: 110 QKVKALVGKVTQKKQHMSHNEEEDEDDASDENYSADEGF 148 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 29.5 bits (63), Expect = 3.6 Identities = 54/263 (20%), Positives = 113/263 (42%), Gaps = 16/263 (6%) Query: 63 AEEQEELGKTIIMARNKKTGKVRIIEVGTVDLKPYLKVDLDNSQLMETSNLDLSRKFGSK 122 ++ QEEL T+ + ++ ++ +E L+ ++ D S+ + NL + S Sbjct: 510 SQSQEELS-TLALELQNRSQILKDMEARNNGLQEEVQEAKDQSKSLNELNLSSAASIKSL 568 Query: 123 KHK--KIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDREAKS 180 + + K+ E +KL+ V+ DQ + Q I + +LS K ++ V ++ Sbjct: 569 QEEVSKLRETIQKLEAEVELRVDQRNALQQEIYCLKEELSQIGKKHQSM-VEQVELVGLH 627 Query: 181 VEQVYDLDKILTEDMFE----KVYEEMENTDYMSNFNEFLKTIVSENMPKKHLVLALYAN 236 E K L E+ + + E +E T + E ++ +V +N+ ++ + L N Sbjct: 628 PESFGSSVKELQEENSKLKEIRERESIEKTALIEKL-EMMEKLVQKNLLLENSISDL--N 684 Query: 237 SLLNMYGTLMKDITKKTYVACPHSASLN---DHILKNFLSIS-NNRKLRTPQM-KDKSLC 291 + L +K + + + + L+ D ++ S + N++KL M + SL Sbjct: 685 AELETIRGKLKTLEEASMSLAEEKSGLHSEKDMLISRLQSATENSKKLSEENMVLENSLF 744 Query: 292 HALVFVLLINKYKFNLEDLCKQL 314 +A V + + +LE+ C L Sbjct: 745 NANVELEELKSKLKSLEESCHLL 767 >At5g47210.1 68418.m05821 nuclear RNA-binding protein, putative similar to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 357 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Query: 116 SRKFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYV 171 +R+ ++++KI+E+++K +Q + + V + E LSN TDE ++ Sbjct: 228 AREMTLEEYEKILEEKKKA---LQATKVEERKVDTKVFESMQQLSNKKNTDEEIFI 280 >At1g11710.1 68414.m01344 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 657 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Query: 194 DMFEKVYEEMENTDYMSNFNEFLKTIVS 221 D F KVY+EM++ Y+ N N F I S Sbjct: 200 DRFWKVYKEMDSLGYVENVNTFNLVIYS 227 >At5g17930.1 68418.m02102 MA3 domain-containing protein low similarity to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profile PF02847: MA3 domain Length = 707 Score = 28.7 bits (61), Expect = 6.3 Identities = 32/143 (22%), Positives = 65/143 (45%), Gaps = 12/143 (8%) Query: 53 LEVCDTLYVGAEEQEELGKTIIMARNKKTGKVRIIEVGTVDLKPYLKVDLDNSQLMETSN 112 LE+ + ++ EL + + K GK+R ++ G DL L LD+ S Sbjct: 98 LEMDTPTVISGDQDAELERRLAKKLKIKKGKLRGMDDGLNDLFEGLPSVLDSM----GSE 153 Query: 113 LDLSRKFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVP 172 L SRK K+ KK E+++ + + + +++ S+++ + K D + Sbjct: 154 LGDSRK---KRKKKRSEEKQDHEDVDELANEDLEHEESEFSDEESEEEPVGKRDRKRH-- 208 Query: 173 PIDREAKSVEQVYDLDKI-LTED 194 ++ KSV++ + D + +T+D Sbjct: 209 --KKKKKSVDEELESDLMNITDD 229 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 28.7 bits (61), Expect = 6.3 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 7/99 (7%) Query: 118 KFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDRE 177 KF HK +EQ N++ D++ N N E + LS + K D+N Y I E Sbjct: 20 KFKETVHK--LEQESGFFFNMKYFEDEVHN--GNWDEVEKYLSGFTKVDDNRYSMKIFFE 75 Query: 178 AKSVEQVYDLDKILTEDMFEKVYEEMENTDYMSNFNEFL 216 + + + LD+ D + V +++ S FNE L Sbjct: 76 IRKQKYLEALDR---HDRPKAVDILVKDLKVFSTFNEEL 111 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 28.7 bits (61), Expect = 6.3 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 7/99 (7%) Query: 118 KFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDRE 177 KF HK +EQ N++ D++ N N E + LS + K D+N Y I E Sbjct: 20 KFKETVHK--LEQESGFFFNMKYFEDEVHN--GNWDEVEKYLSGFTKVDDNRYSMKIFFE 75 Query: 178 AKSVEQVYDLDKILTEDMFEKVYEEMENTDYMSNFNEFL 216 + + + LD+ D + V +++ S FNE L Sbjct: 76 IRKQKYLEALDR---HDRPKAVDILVKDLKVFSTFNEEL 111 >At1g63300.1 68414.m07156 expressed protein similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum] Length = 1029 Score = 28.7 bits (61), Expect = 6.3 Identities = 41/170 (24%), Positives = 80/170 (47%), Gaps = 21/170 (12%) Query: 29 ITDNFKDTECTILRDEITS-KRNVALEVCDTLYVGAEEQEELGKTIIMARNKKTGKVRII 87 +T N E IL++EI + K+N D+L + AE+ E L + +KT K + Sbjct: 722 VTANLNQ-EIKILKEEIENLKKNQ-----DSLMLQAEQAENLRVDL-----EKTKKSVME 770 Query: 88 EVGTVDLKPYLKVDLDNS-QLMETSNLDLSRKFGSKKHKKIMEQR--EKLKVNVQTVTDQ 144 ++ + K++L++ LM + L+ + K K ++ L+ ++TV Q Sbjct: 771 AEASLQRENMKKIELESKISLMRKESESLAAELQVIKLAKDEKETAISLLQTELETVRSQ 830 Query: 145 MQNVSQNISEDQLDLSNYNKTDENFYVPPIDREAKSVEQ-VYDLDKILTE 193 ++ ++SE+ L++ + K V + E K E+ + +L+K L E Sbjct: 831 CDDLKHSLSENDLEMEKHKK-----QVAHVKSELKKKEETMANLEKKLKE 875 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 28.3 bits (60), Expect = 8.4 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 5/84 (5%) Query: 174 IDREAKSVEQVYDLDKILTEDMFEKVYE-----EMENTDYMSNFNEFLKTIVSENMPKKH 228 +D A V ++ ++TED+ E++ + EM+ D +S + + IV + K+ Sbjct: 609 VDDLAMQVAACPQVEYLVTEDVSEEIVKKEKEIEMQKEDLLSKPEQIREKIVDGRIKKRL 668 Query: 229 LVLALYANSLLNMYGTLMKDITKK 252 LAL + ++KD+ K+ Sbjct: 669 DSLALLEQPYIKDDKVIVKDLVKQ 692 >At3g22860.1 68416.m02882 eukaryotic translation initiation factor 3 subunit 8, putative / eIF3c, putative similar to eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110) [Arabidopsis thaliana] SWISS-PROT:O49160 Length = 800 Score = 28.3 bits (60), Expect = 8.4 Identities = 30/142 (21%), Positives = 57/142 (40%), Gaps = 8/142 (5%) Query: 97 YLKVDLDNSQLMETSNLDLSRKFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQ 156 Y+K + + N+ K + K + R+KLK N Q Q + E Sbjct: 98 YIKTLVMLEDFLNEDNMKTKEKMSTSNSKALNAMRQKLKKN----NLQYQEDIKRFRESP 153 Query: 157 LDLSNYNKTDENFYVPPIDREAKSVEQVYDLD-KILTEDMFEKVYEEMENTDYMSNFNEF 215 ++ + ++ +E D S E ++ LD + +T +M K ++E+ + + Sbjct: 154 -EIEDDDEYEEEVVEDSADN--VSWEMLFSLDHEEITWNMVNKKFKEIRAARWSKRRSSS 210 Query: 216 LKTIVSENMPKKHLVLALYANS 237 LK E +KH+ L A + Sbjct: 211 LKLKPGETHAQKHMDLTKIAKT 232 >At2g38720.1 68415.m04755 microtubule associated protein (MAP65/ASE1) family protein low similarity to myosin [Schistosoma japonicum] GI:3941320; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 587 Score = 28.3 bits (60), Expect = 8.4 Identities = 44/215 (20%), Positives = 90/215 (41%), Gaps = 17/215 (7%) Query: 114 DLSRKFGSKKHKKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTD-ENFYVP 172 D RK S+ +I E + N TV+ + ++++ +LD + D N Sbjct: 110 DRRRKELSETLNQIAEITSNIAGNDYTVSSGSEVDESDLTQRKLDELRADLQDLRNEKAV 169 Query: 173 PIDREAKSVEQVYDLDKILTEDM-------------FEKVYEEMENTDYMSNFNEFLKTI 219 + + + V++L +IL+ D F K + + + D ++ F E +K++ Sbjct: 170 RLQKVNSYISAVHELSEILSFDFSKALNSVHSSLTEFSKTHSKSISNDTLARFTELVKSL 229 Query: 220 VSENMPK--KHLVLALYANSLLNMYGTLMKDITKKTYVACPHSASLNDHILKNFLSISNN 277 +E + K L L N+ T M + + + + S+ +D + K LS+ Sbjct: 230 KAEKHERLLKLQGLGRSMQELWNLMETPMDERRRFDHCSSLLSSLPDDALKKGCLSLDII 289 Query: 278 RKLRTPQMKDKSLCHALVFVLLINKYKFNLEDLCK 312 R+ + SL + + L+ K + LE++C+ Sbjct: 290 REAEDEVRRLNSLKSSKMKELVF-KRQCELEEICR 323 >At1g57780.1 68414.m06556 heavy-metal-associated domain-containing protein low similarity to myosin-like antigen GI:159877 Onchocerca volvulus; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 264 Score = 28.3 bits (60), Expect = 8.4 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Query: 100 VDLDNSQLMETSNLD---LSRKFGSKKHKKIMEQREK 133 VDL+N +++ N D LSRK K H+KI + ++ Sbjct: 166 VDLENKKVVVIGNFDKDELSRKLNKKMHQKIKKAEKE 202 >At1g06950.1 68414.m00738 chloroplast inner envelope protein-related similar to chloroplast inner envelope protein GI:1495767 from [Pisum sativum] Length = 1016 Score = 28.3 bits (60), Expect = 8.4 Identities = 24/101 (23%), Positives = 49/101 (48%), Gaps = 2/101 (1%) Query: 125 KKIMEQREKLKVNVQTVTDQMQNVSQNISEDQLDLSNYNKTDENFYVPPIDREAKSVEQV 184 K +EQ ++L+ V Q + V +NI+ ++ +N +T N I + + E Sbjct: 795 KARVEQLDELQKQVGLPQPQAEKVIKNITTTKM--ANAIETAVNQGRLNIKQIRELKEAN 852 Query: 185 YDLDKILTEDMFEKVYEEMENTDYMSNFNEFLKTIVSENMP 225 LD ++ + EK++++ + + S EF +T V + +P Sbjct: 853 VSLDSMIAVSLREKLFKKTVSDIFSSGTGEFDETEVYQTIP 893 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.132 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,055,228 Number of Sequences: 28952 Number of extensions: 331495 Number of successful extensions: 1236 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 25 Number of HSP's that attempted gapping in prelim test: 1225 Number of HSP's gapped (non-prelim): 37 length of query: 359 length of database: 12,070,560 effective HSP length: 82 effective length of query: 277 effective length of database: 9,696,496 effective search space: 2685929392 effective search space used: 2685929392 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 60 (28.3 bits)
- SilkBase 1999-2023 -