BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001678-TA|BGIBMGA001678-PA|IPR005806|Rieske [2Fe-2S] region (348 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26F1.14c |aif1|SPAC29A4.01c|apoptosis-inducing factor homolo... 38 0.003 SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2... 27 3.9 SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|S... 27 5.2 SPBC1921.07c ||SPBC21D10.13|SAGA complex subunit Sgf29 |Schizosa... 26 6.9 SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 26 6.9 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 26 9.1 >SPAC26F1.14c |aif1|SPAC29A4.01c|apoptosis-inducing factor homolog Aif1|Schizosaccharomyces pombe|chr 1|||Manual Length = 575 Score = 37.5 bits (83), Expect = 0.003 Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 6/64 (9%) Query: 62 CPHLGANLAVGGTVRGSCIECPFHKWRFNAAGTCVSLPGSDIAPKGVSIRTWCVVET-DG 120 C H GA LA G I CP+H FNAA V + P ++RT+ V E DG Sbjct: 61 CSHYGAPLAKGVVTSDGHIVCPWHGACFNAATGDV-----EDTPAIAALRTFPVTEEGDG 115 Query: 121 AIWI 124 ++WI Sbjct: 116 SLWI 119 >SPBC24C6.09c |||phosphoketolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 825 Score = 27.1 bits (57), Expect = 3.9 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 10/46 (21%) Query: 225 KYDLARIDVKVTQIGPGH------VRLFLKTSVGPFYIAQSVTPLG 264 KYDL + V +GPGH LFL+ S+GPFY T G Sbjct: 118 KYDLNMLFV----VGPGHGAPAILSALFLEDSLGPFYPRYQFTKEG 159 >SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 26.6 bits (56), Expect = 5.2 Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 36 YSFGCHGQNLCVYRGE 51 +SFG H QN+C+Y E Sbjct: 101 FSFGAHCQNMCLYGDE 116 >SPBC1921.07c ||SPBC21D10.13|SAGA complex subunit Sgf29 |Schizosaccharomyces pombe|chr 2|||Manual Length = 244 Score = 26.2 bits (55), Expect = 6.9 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Query: 129 EGREPLWEITDPPELKDFGYRGRNEFEVSAHIQEIPENGADVPHLN 174 EG + +E+ DP E D G G+ + H+ +IP G +P ++ Sbjct: 145 EGAKQRFEVQDP-EPDDDGNAGQIYKTTANHLIQIPAKGTPLPPIS 189 >SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 26.2 bits (55), Expect = 6.9 Identities = 12/38 (31%), Positives = 24/38 (63%) Query: 214 LMHITQEYKVLKYDLARIDVKVTQIGPGHVRLFLKTSV 251 +++ITQ+ K L V++T++GP H+R+ K ++ Sbjct: 279 VVNITQKPKTKYKPLPLSTVELTKLGPKHLRISAKKTL 316 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 25.8 bits (54), Expect = 9.1 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Query: 146 FGYRGRNEFEVSAHIQEIPENGADVPHLNAVH--SSSLLSDLGERYPVLHEIIGRHVWNA 203 FG+R N F S H ++ N +P+ + + S++L + G RY L + A Sbjct: 436 FGFRLLNPFIASQHFDQMIHNNLRLPYDSCMGYISNALNAIYGFRYVALQDSYPNPGPLA 495 Query: 204 DWTKSDDH 211 D+ + D + Sbjct: 496 DYFEQDQY 503 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.321 0.139 0.456 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,759,233 Number of Sequences: 5004 Number of extensions: 76351 Number of successful extensions: 149 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 146 Number of HSP's gapped (non-prelim): 6 length of query: 348 length of database: 2,362,478 effective HSP length: 73 effective length of query: 275 effective length of database: 1,997,186 effective search space: 549226150 effective search space used: 549226150 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -