BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001678-TA|BGIBMGA001678-PA|IPR005806|Rieske [2Fe-2S] region (348 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 23 4.3 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 5.7 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 5.7 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 5.7 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 5.7 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 7.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 7.6 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 22.6 bits (46), Expect = 4.3 Identities = 11/29 (37%), Positives = 14/29 (48%) Query: 262 PLGPLLQKVIHRVYSPAYNAPVGAFLVRC 290 P P + R SP +AP G +VRC Sbjct: 79 PQWPFAWGSLXRSSSPQTSAPTGPPIVRC 107 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 58 VDAYCPHLGANLAVGGTVRGSCIECPFHKWRFN 90 + AY P A++ V+ + P HKW+ N Sbjct: 200 IGAYGPEKSASIPKKKEVKEEIEDEPDHKWKKN 232 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/46 (26%), Positives = 18/46 (39%) Query: 301 IWNSKRFVSAPAYVKTDKTIRTFRNWFGQFYSEHSLSFRDALQNPL 346 +W A++K K IR + W Y L FR + + L Sbjct: 98 VWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLGFRYLVNDEL 143 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 5.7 Identities = 12/46 (26%), Positives = 18/46 (39%) Query: 301 IWNSKRFVSAPAYVKTDKTIRTFRNWFGQFYSEHSLSFRDALQNPL 346 +W A++K K IR + W Y L FR + + L Sbjct: 412 VWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLGFRYLVNDEL 457 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 94 TCVSLPGSDIAPKGVS 109 +CVS+P + +P+G S Sbjct: 33 SCVSMPSMNCSPQGAS 48 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/39 (28%), Positives = 15/39 (38%) Query: 301 IWNSKRFVSAPAYVKTDKTIRTFRNWFGQFYSEHSLSFR 339 +W A++K K IR + W Y L FR Sbjct: 645 VWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLGFR 683 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.8 bits (44), Expect = 7.6 Identities = 11/39 (28%), Positives = 15/39 (38%) Query: 301 IWNSKRFVSAPAYVKTDKTIRTFRNWFGQFYSEHSLSFR 339 +W A++K K IR + W Y L FR Sbjct: 645 VWTLPGKTKMIAHLKDKKKIRAKKRWSQCMYMYFLLGFR 683 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.139 0.456 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,216 Number of Sequences: 317 Number of extensions: 4075 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 7 length of query: 348 length of database: 114,650 effective HSP length: 57 effective length of query: 291 effective length of database: 96,581 effective search space: 28105071 effective search space used: 28105071 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -