BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001674-TA|BGIBMGA001674-PA|IPR000504|RNA-binding region RNP-1 (RNA recognition motif) (147 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 5.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 1.5 Identities = 12/41 (29%), Positives = 17/41 (41%) Query: 94 KLAMMKMNGSEPLNLKISIAHKLYPYHDTHRMNVRWAKIYV 134 K + KM G +P + A YP T ++ W K V Sbjct: 1264 KYQLPKMGGPQPYSACSENAFAAYPGDCTRYLHCLWGKYEV 1304 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 5.9 Identities = 7/22 (31%), Positives = 12/22 (54%) Query: 102 GSEPLNLKISIAHKLYPYHDTH 123 G + L+ + H ++PYH H Sbjct: 35 GLQGLHHSPHLNHAMHPYHANH 56 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.131 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,765 Number of Sequences: 317 Number of extensions: 1198 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 147 length of database: 114,650 effective HSP length: 51 effective length of query: 96 effective length of database: 98,483 effective search space: 9454368 effective search space used: 9454368 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -