BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001674-TA|BGIBMGA001674-PA|IPR000504|RNA-binding region RNP-1 (RNA recognition motif) (147 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 0.99 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 0.99 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 0.99 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 0.99 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 0.99 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 0.99 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 0.99 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 0.99 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 0.99 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 0.99 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 1.3 AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex det... 20 9.3 AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex det... 20 9.3 AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex det... 20 9.3 AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex det... 20 9.3 AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex det... 20 9.3 AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex det... 20 9.3 AY569702-1|AAS86655.1| 400|Apis mellifera complementary sex det... 20 9.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 20 9.3 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 315 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 364 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.4 bits (48), Expect = 0.99 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 315 ISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 364 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.0 bits (47), Expect = 1.3 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 1 MSNHSRPQRRREWDPMRDDFNEHTYDVQYADDNAGEQVQLDHTKLYIINIP 51 +SN++ ++ +++N+H Y+ Y + N EQ+ + +Y N P Sbjct: 82 ISNNNPLSNNYNYNNNYNNYNKHNYNKLYYNINYIEQIPIP-VPVYCGNFP 131 >AY569719-1|AAS86672.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 >AY569718-1|AAS86671.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 >AY569715-1|AAS86668.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 >AY569714-1|AAS86667.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 >AY569713-1|AAS86666.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 >AY569711-1|AAS86664.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 >AY569702-1|AAS86655.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.2 bits (40), Expect = 9.3 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 2 SNHSRPQRRREWDPMRDDFNEH 23 + R +RRREW ++ EH Sbjct: 31 TQEERLRRRREWMIQQEREREH 52 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.131 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,098 Number of Sequences: 429 Number of extensions: 1536 Number of successful extensions: 19 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of query: 147 length of database: 140,377 effective HSP length: 52 effective length of query: 95 effective length of database: 118,069 effective search space: 11216555 effective search space used: 11216555 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -