BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001673-TA|BGIBMGA001673-PA|undefined (172 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 1.4 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 5.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 5.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.5 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 23.0 bits (47), Expect = 1.4 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 145 SSSTGDNHAAFSSVSTH 161 SSST N++A+SS S H Sbjct: 143 SSSTWCNYSAYSSASRH 159 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Query: 59 KSKSSTVVPQQASIAASTGP 78 K K TVVP+ + + GP Sbjct: 152 KCKPKTVVPEVGGVEEAKGP 171 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.0 bits (42), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 65 VVPQQASIAASTGPSQPTHRASWSYG 90 V+P + A+S G P H +S+ G Sbjct: 106 VLPGNYANASSVGSRNPIHTSSYMTG 131 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.0 bits (42), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 65 VVPQQASIAASTGPSQPTHRASWSYG 90 V+P + A+S G P H +S+ G Sbjct: 339 VLPGNYANASSVGSRNPIHTSSYMTG 364 Score = 21.0 bits (42), Expect = 5.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 44 RINNLGYHNPRILEDKSKSSTVVPQQASIA 73 +I + +NP I + KS V Q+ SIA Sbjct: 1400 QIGSTSSNNPSISAFRKKSLAYVQQRMSIA 1429 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.0 bits (42), Expect = 5.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Query: 65 VVPQQASIAASTGPSQPTHRASWSYG 90 V+P + A+S G P H +S+ G Sbjct: 339 VLPGNYANASSVGSRNPIHTSSYMTG 364 Score = 21.0 bits (42), Expect = 5.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 44 RINNLGYHNPRILEDKSKSSTVVPQQASIA 73 +I + +NP I + KS V Q+ SIA Sbjct: 1400 QIGSTSSNNPSISAFRKKSLAYVQQRMSIA 1429 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.126 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 42,008 Number of Sequences: 317 Number of extensions: 1639 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 172 length of database: 114,650 effective HSP length: 53 effective length of query: 119 effective length of database: 97,849 effective search space: 11644031 effective search space used: 11644031 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -