BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001672-TA|BGIBMGA001672-PA|undefined (206 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.2 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.2 Identities = 22/80 (27%), Positives = 32/80 (40%), Gaps = 3/80 (3%) Query: 47 PSSKPSGGSPVLRNAISDALMKKQGPNVIDR--RVGIAALIQRRQDEGTQHP-DPESDEN 103 P+S GSP SD + K P + G + ++ G P PE +E Sbjct: 279 PNSTTMNGSPGSGGIRSDQMGVKIEPAEAESLSTSGSSGILTPVSPYGYVKPISPEQEEL 338 Query: 104 TMRLKLFRLMYETVRDSDMK 123 RL F+ YE + D+K Sbjct: 339 IHRLVYFQNEYEQPSEEDLK 358 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.132 0.373 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,458 Number of Sequences: 429 Number of extensions: 2254 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 1 length of query: 206 length of database: 140,377 effective HSP length: 55 effective length of query: 151 effective length of database: 116,782 effective search space: 17634082 effective search space used: 17634082 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -