BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001669-TA|BGIBMGA001669-PA|IPR001993|Mitochondrial substrate carrier (326 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 9.3 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 9.3 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 70 TKIYASEGVSGLYRGFWLSSIISGVFYISTYEGVR 104 TKI+ G L++ + I++ +F +GVR Sbjct: 5 TKIFPVPGDKNLHKSYSKMLILAQIFGFFPVQGVR 39 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Query: 70 TKIYASEGVSGLYRGFWLSSIISGVFYISTYEGVR 104 TKI+ G L++ + I++ +F +GVR Sbjct: 5 TKIFPVPGDKNLHKSYSKMLILAQIFGFFPVQGVR 39 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 73,061 Number of Sequences: 317 Number of extensions: 2874 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 326 length of database: 114,650 effective HSP length: 57 effective length of query: 269 effective length of database: 96,581 effective search space: 25980289 effective search space used: 25980289 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -