SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001668-TA|BGIBMGA001668-PA|undefined
         (104 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    20   5.9  
EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive pep...    19   7.9  

>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 19.8 bits (39), Expect = 5.9
 Identities = 11/43 (25%), Positives = 22/43 (51%)

Query: 15  IAFVAFMDLGTAGRSYIEGRSFLNNNGETEHLDVITLLGLVYL 57
           I  + +++    G+  I   +   N  E+E  D ++LL LV++
Sbjct: 104 IEILGYVNKAKFGKLLINLYTINYNFKESERNDYVSLLQLVFV 146


>EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive
           peptide receptor 1 protein.
          Length = 374

 Score = 19.4 bits (38), Expect = 7.9
 Identities = 6/10 (60%), Positives = 9/10 (90%)

Query: 61  LRLFGTVPGT 70
           L++FG +PGT
Sbjct: 273 LQVFGQIPGT 282


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.139    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,884
Number of Sequences: 317
Number of extensions: 1051
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of query: 104
length of database: 114,650
effective HSP length: 49
effective length of query: 55
effective length of database: 99,117
effective search space:  5451435
effective search space used:  5451435
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.5 bits)
S2: 38 (19.4 bits)

- SilkBase 1999-2023 -