BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001668-TA|BGIBMGA001668-PA|undefined (104 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. 25 0.75 AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. 25 0.75 AY118044-1|AAM54225.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118042-1|AAM54223.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118041-1|AAM54222.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118040-1|AAM54221.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118039-1|AAM54220.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118038-1|AAM54219.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118037-1|AAM54218.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118036-1|AAM54217.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118035-1|AAM54216.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AY118034-1|AAM54215.1| 69|Anopheles gambiae xanthine dehydroge... 22 4.0 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 21 7.0 AY118045-1|AAM54226.1| 69|Anopheles gambiae xanthine dehydroge... 21 9.2 AY118043-1|AAM54224.1| 69|Anopheles gambiae xanthine dehydroge... 21 9.2 >AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 24.6 bits (51), Expect = 0.75 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query: 30 YIEGRSFLNNNGETEHLDVITLLGLVYLPNKLRLFGTVPGTSGMDREVEDE 80 Y+ R F+++ E +D I +L Y+ + ++FG + + RE EDE Sbjct: 20 YMGKRDFVDHVSGVEPIDGIVVLDDEYIRDNRKVFGQIVCSFRYGRE-EDE 69 >AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 24.6 bits (51), Expect = 0.75 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Query: 30 YIEGRSFLNNNGETEHLDVITLLGLVYLPNKLRLFGTVPGTSGMDREVEDE 80 Y+ R F+++ E +D I +L Y+ + ++FG + + RE EDE Sbjct: 20 YMGKRDFVDHVSGVEPIDGIVVLDDEYIRDNRKVFGQIVCSFRYGRE-EDE 69 >AY118044-1|AAM54225.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118042-1|AAM54223.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118041-1|AAM54222.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118040-1|AAM54221.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118039-1|AAM54220.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118038-1|AAM54219.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118037-1|AAM54218.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118036-1|AAM54217.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118035-1|AAM54216.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AY118034-1|AAM54215.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 LVYL KLRL GT G Sbjct: 39 LVYLREKLRLCGTKLG 54 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 62 RLFGTVPGTSGMDREVED 79 R+ +PG + REVED Sbjct: 184 RVVAEIPGCAEFQREVED 201 >AY118045-1|AAM54226.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 L+YL KLRL GT G Sbjct: 39 LMYLREKLRLCGTKLG 54 >AY118043-1|AAM54224.1| 69|Anopheles gambiae xanthine dehydrogenase protein. Length = 69 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Query: 54 LVYLPNKLRLFGTVPG 69 L+YL KLRL GT G Sbjct: 39 LMYLREKLRLCGTKLG 54 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.322 0.139 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,498 Number of Sequences: 2123 Number of extensions: 4269 Number of successful extensions: 17 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 15 length of query: 104 length of database: 516,269 effective HSP length: 55 effective length of query: 49 effective length of database: 399,504 effective search space: 19575696 effective search space used: 19575696 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -