BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001665-TA|BGIBMGA001665-PA|IPR011497|Protease inhibitor, Kazal-type (153 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 4.2 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 4.2 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 21 4.2 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 4.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 5.6 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.3 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 53 YKEYDALCPSSCPALNVMVCAECGHGIYRT 82 +K DA C + +VM E HG+ T Sbjct: 52 FKHTDACCRTHDMCPDVMSAGESKHGLTNT 81 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 53 YKEYDALCPSSCPALNVMVCAECGHGIYRT 82 +K DA C + +VM E HG+ T Sbjct: 57 FKHTDACCRTHDMCPDVMSAGESKHGLTNT 86 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.4 bits (43), Expect = 4.2 Identities = 7/14 (50%), Positives = 7/14 (50%) Query: 63 SCPALNVMVCAECG 76 SCP L C CG Sbjct: 66 SCPVLRAYTCPICG 79 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Query: 53 YKEYDALCPSSCPALNVMVCAECGHGIYRT 82 +K DA C + +VM E HG+ T Sbjct: 57 FKHTDACCRTHDMCPDVMSAGESKHGLTNT 86 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.0 bits (42), Expect = 5.6 Identities = 9/30 (30%), Positives = 13/30 (43%) Query: 61 PSSCPALNVMVCAECGHGIYRTFLSVCHMR 90 PS + + + C E + FL VC R Sbjct: 320 PSQASSCSCLDCDEIRESLDTQFLQVCRSR 349 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 20.6 bits (41), Expect = 7.3 Identities = 13/44 (29%), Positives = 20/44 (45%) Query: 87 CHMRMFRCRHHEENIQLASREPCMMSAPYLSEDVMRPKGRMSKS 130 C +RM R EE S++P ++ S + + R SKS Sbjct: 342 CILRMSRPSDKEEREAQKSQKPSPVTGASKSHGDLELRQRSSKS 385 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.133 0.415 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 39,448 Number of Sequences: 429 Number of extensions: 1208 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 153 length of database: 140,377 effective HSP length: 53 effective length of query: 100 effective length of database: 117,640 effective search space: 11764000 effective search space used: 11764000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -