BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001664-TA|BGIBMGA001664-PA|IPR005829|Sugar transporter superfamily, IPR007114|Major facilitator superfamily, IPR003663|Sugar transporter, IPR005828|General substrate transporter (469 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 26 0.59 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 26.2 bits (55), Expect = 0.59 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 13/83 (15%) Query: 350 ITVATSYTQHVW-VSYLCIALVVLFVTMFAIGPGSIPWFLVTELFNQSSRPAASSVAVTV 408 + V SY + +++ ++++ T++A+ IP E FN+S + V Sbjct: 805 LLVCNSYVDASYMIAFAYPIMLIVVCTVYAVLTRKIP-----EAFNESKHIGFTMYTTCV 859 Query: 409 NWTANFIVGLSFLPLSLALGNNV 431 W L+F+PL GNNV Sbjct: 860 IW-------LAFVPLYFGTGNNV 875 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.323 0.135 0.402 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,739 Number of Sequences: 429 Number of extensions: 3130 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 1 length of query: 469 length of database: 140,377 effective HSP length: 60 effective length of query: 409 effective length of database: 114,637 effective search space: 46886533 effective search space used: 46886533 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -