SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001664-TA|BGIBMGA001664-PA|IPR005829|Sugar transporter
superfamily, IPR007114|Major facilitator superfamily, IPR003663|Sugar
transporter, IPR005828|General substrate transporter
         (469 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat...    26   0.59 

>AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate
           receptor protein.
          Length = 1040

 Score = 26.2 bits (55), Expect = 0.59
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 350 ITVATSYTQHVW-VSYLCIALVVLFVTMFAIGPGSIPWFLVTELFNQSSRPAASSVAVTV 408
           + V  SY    + +++    ++++  T++A+    IP     E FN+S     +     V
Sbjct: 805 LLVCNSYVDASYMIAFAYPIMLIVVCTVYAVLTRKIP-----EAFNESKHIGFTMYTTCV 859

Query: 409 NWTANFIVGLSFLPLSLALGNNV 431
            W       L+F+PL    GNNV
Sbjct: 860 IW-------LAFVPLYFGTGNNV 875


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.323    0.135    0.402 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,739
Number of Sequences: 429
Number of extensions: 3130
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 469
length of database: 140,377
effective HSP length: 60
effective length of query: 409
effective length of database: 114,637
effective search space: 46886533
effective search space used: 46886533
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 45 (22.2 bits)

- SilkBase 1999-2023 -