BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001662-TA|BGIBMGA001662-PA|undefined (257 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.01 |||PWWP domain protein|Schizosaccharomyces pombe|chr... 28 1.2 SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 8.2 >SPAC23D3.01 |||PWWP domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 407 Score = 28.3 bits (60), Expect = 1.2 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Query: 80 FESEKQNRGYAFPVENVVKRACAATGLSESTIKRIKRDGLRAEATQTRMTGPKKRRVR 137 FE E + P+E K AT + KR+K + AE +QT P +R R Sbjct: 169 FEPENTRKKLQKPIEKPKKEKIEATPKIDGG-KRLKNEKSSAEISQTSKQRPSRRSAR 225 >SPBC21C3.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 841 Score = 25.4 bits (53), Expect = 8.2 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query: 72 LIYKVIKFF--ESEKQNRGYAFPVENVVKRACAATG-LSESTIKRI 114 LI KV + ESEK Y ++NV+K+ + G ++ S ++R+ Sbjct: 468 LIQKVYSYITAESEKVGNRYGETLDNVIKQHLSRIGSVASSAVQRL 513 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,899 Number of Sequences: 5004 Number of extensions: 21829 Number of successful extensions: 46 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 46 Number of HSP's gapped (non-prelim): 2 length of query: 257 length of database: 2,362,478 effective HSP length: 71 effective length of query: 186 effective length of database: 2,007,194 effective search space: 373338084 effective search space used: 373338084 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -