BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001662-TA|BGIBMGA001662-PA|undefined (257 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0683 - 35522534-35522647,35523009-35523143,35523224-355233... 30 2.1 01_06_1723 - 39443176-39443505,39443615-39443710,39443834-394439... 28 6.4 >03_06_0683 - 35522534-35522647,35523009-35523143,35523224-35523346, 35523640-35523741,35523884-35524090,35524634-35524748, 35524839-35525048,35525135-35525234,35525448-35525609, 35525737-35526073,35526472-35526678,35527284-35527736 Length = 754 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Query: 77 IKFFESEKQNRGYAFPVENVVKRACAATGLSESTIKRIKRDGL 119 +KF+ S QN + +EN+ KRA AT L + +++R DGL Sbjct: 212 LKFYISHAQNLPF---IENMEKRAQGATKLLDGSLERCFVDGL 251 >01_06_1723 - 39443176-39443505,39443615-39443710,39443834-39443902, 39444381-39444443,39444521-39444598,39444725-39444838, 39445727-39445804,39446457-39446522,39446739-39446804, 39446896-39447003,39447355-39447432,39447951-39448010, 39448087-39448191,39448407-39448595,39448922-39448985, 39449244-39449385,39449494-39449654,39449952-39450076, 39450230-39450300,39450410-39450560,39450713-39450769, 39451049-39451143,39451331-39451379 Length = 804 Score = 28.3 bits (60), Expect = 6.4 Identities = 32/144 (22%), Positives = 61/144 (42%), Gaps = 7/144 (4%) Query: 59 KKKKEAIDGQARELIYKVIKFFESEKQNRGYAFPVENVVKRACAATGLSESTIKRIKRDG 118 K++ A +EL++K+ + +Q+ + +K+ A +TI + R Sbjct: 56 KEELAAATNAVQELMHKIHEIKTKAEQSESMVQEICRDIKKLDCAKRHITTTITALHRLT 115 Query: 119 LRAEATQTRMTGPKKRRVRKTKVQLDYF-QLC----ALRSIVNGYSMRKEVPTLGKILAA 173 + A + KR+ ++ QL+ QLC A R + +R++ + KIL + Sbjct: 116 MLVSAVEQLQVMASKRQYKEAAAQLEAVNQLCSHFEAYRDVPKITELREKFKNIKKILKS 175 Query: 174 -AKHELNYCG-GKESLRLILLNKL 195 + G GKE+ LL +L Sbjct: 176 HVFSDFTSLGTGKETEDATLLQQL 199 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,855,059 Number of Sequences: 37544 Number of extensions: 135457 Number of successful extensions: 269 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 269 Number of HSP's gapped (non-prelim): 2 length of query: 257 length of database: 14,793,348 effective HSP length: 81 effective length of query: 176 effective length of database: 11,752,284 effective search space: 2068401984 effective search space used: 2068401984 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -