GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001662-TA|BGIBMGA001662-PA|undefined
         (257 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF457566-1|AAL68796.1|  147|Anopheles gambiae multiprotein bridg...    29   0.13 

>AF457566-1|AAL68796.1|  147|Anopheles gambiae multiprotein bridging
           factor-like proteinprotein.
          Length = 147

 Score = 29.1 bits (62), Expect = 0.13
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 102 AATGLSESTIKRIKRDGLRAEATQTRMTGPKKRRV-RKTKVQLD 144
           AAT  +ES I + +R G+  E TQ    G  K+ V  K   +LD
Sbjct: 19  AATLKTESAINKARRQGIPVETTQKFNAGTNKQHVAAKNTAKLD 62


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.318    0.133    0.378 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 172,171
Number of Sequences: 2123
Number of extensions: 5139
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4
Number of HSP's gapped (non-prelim): 1
length of query: 257
length of database: 516,269
effective HSP length: 63
effective length of query: 194
effective length of database: 382,520
effective search space: 74208880
effective search space used: 74208880
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 47 (23.0 bits)