BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001660-TA|BGIBMGA001660-PA|IPR007087|Zinc finger, C2H2-type (240 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) 35 0.052 SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_22532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.85 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_10554| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.85 SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_3592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_29933| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.5 SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 2.0 SB_21061| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.6 SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.6 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_33309| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.6 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.4 SB_48438| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_50428| Best HMM Match : zf-C2H2 (HMM E-Value=2e-16) 29 4.5 SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.5 SB_43175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.5 SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.5 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.5 SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 4.5 SB_17147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_42412| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-33) 28 6.0 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_9023| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_21206| Best HMM Match : PaREP8 (HMM E-Value=2.4) 28 6.0 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.9 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.9 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 7.9 SB_18177| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 777 Score = 35.1 bits (77), Expect = 0.052 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 132 IELSDAELGAER-ERAIRDPRYTKKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQG 190 I+++D G + E D T+K+YKC +C ++ NL RHL + + D+ Sbjct: 443 IKMADQSRGEKSPENTSNDSLRTEKTYKCDECGKCFNRKTNLKRHLIIHSRRKPYKCDEC 502 Query: 191 V 191 V Sbjct: 503 V 503 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 +KSYKC +C + + NL +HL + + D+ G S + + R H G Sbjct: 520 RKSYKCDECGKCFSESGNLKKHLIIHSRRKLYKCDEFGKSFTQHYHLKTHVRIHSG 575 >SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 +K YKC C + + N D+H L NE R D G S + + RRH G Sbjct: 122 EKPYKCDICGRKFSLSSNRDKHFRLHTNEKPFRCDHCGKCFTHSGNLKEHIRRHSG 177 >SB_22532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 32.3 bits (70), Expect = 0.37 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 151 RYTKKSYKCQKCIISYDHAINLDRHLTLSH 180 RY +K Y+C KC Y N RH++ +H Sbjct: 466 RYLEKHYRCMKCFSVYSSRNNFLRHVSKAH 495 >SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 31.5 bits (68), Expect = 0.64 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 +K YKC +C ++ + NL HL + + + D G S S A+ + R H G Sbjct: 271 EKPYKCDECGKCFNQSANLKTHLRIHTGQKPCKCDACGKSFNQSGALKRHLRIHSG 326 >SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 618 Score = 31.1 bits (67), Expect = 0.85 Identities = 10/41 (24%), Positives = 23/41 (56%) Query: 149 DPRYTKKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ 189 D + +K ++C +C++S+ +L RHL + N + ++ Sbjct: 332 DGEHGEKPFRCTQCVMSFTRPSDLQRHLLIHSNSKPYKCEE 372 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEV-ALRLDQGVSLFSSVAIANYRRRHVGLGCS 212 +K Y C +C +S+ H L H+ H+ + + D+ + F + ++ R+HV C Sbjct: 829 EKPYVCNRCGVSFRHDSTLTMHIRTRHDHLRPFKCDECGNTFGRL---SHLRKHVRKVCG 885 Query: 213 DER 215 + R Sbjct: 886 NRR 888 >SB_10554| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 194 Score = 31.1 bits (67), Expect = 0.85 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Query: 133 ELSDAE-LGAERERAIRDPRYTKKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-G 190 EL D E + E +A+ ++K Y+C +C + + L RHL + + R D+ G Sbjct: 25 ELFDLEKIAKEASKALN---LSEKPYECGECGMGFTRHAYLKRHLRIHSGQKPYRCDECG 81 Query: 191 VSLFSSVAIANYRRRHVG 208 S A+ + R H G Sbjct: 82 KGFTQSGALNRHLRIHSG 99 >SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 31.1 bits (67), Expect = 0.85 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSVAIANYRRRHVGLGCSD 213 K+ +KC KC S+ + L H+ HN + D F A ++H+ + C Sbjct: 126 KRPFKCDKCWWSFKNPSGLREHIKAVHNSEKFKCDYCEKDFK---YAKSLKQHIEVHCDP 182 Query: 214 ERL 216 +R+ Sbjct: 183 KRV 185 >SB_3592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 155 KSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 K YKC +C Y+ +L RHL + + D+ G S A+ ++ R H G Sbjct: 128 KPYKCNECGKCYNQTSSLKRHLRTHTGQKPYKCDECGKCFNQSGALNSHLRIHSG 182 >SB_29933| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 420 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLD 188 +K Y+C KC + ++NL RHL + + + D Sbjct: 293 QKPYECDKCGKCFSESVNLKRHLMIDTGQKPYKCD 327 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLD 188 +K Y+C +C+ + + NL RHL + + + D Sbjct: 349 QKPYECDECVECFSESGNLKRHLMIHTGQKPYKCD 383 >SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 366 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 +K YKC +C ++ + NL HL + + + D+ G V + + + H G Sbjct: 199 QKPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIHTG 254 >SB_21061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 2.0 Identities = 10/31 (32%), Positives = 19/31 (61%) Query: 152 YTKKSYKCQKCIISYDHAINLDRHLTLSHNE 182 + +K +KC C +S+ I+L RH+ +H + Sbjct: 509 HQEKPFKCSDCKMSFRQRISLQRHVIKTHGQ 539 >SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 928 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 155 KSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLF-SSVAIANYRRRHVG 208 K +KC C ++ + L RH+ L H + D F S A+A ++ H G Sbjct: 870 KPFKCDTCEKAFRSSSELTRHVKLVHVKKPFPCDTCKQAFRSEDALARHKNTHAG 924 >SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 KK YKC +C + + L HL + + + D+ G S A+ + R H G Sbjct: 271 KKPYKCDECGNCFSESGQLKVHLRIHSGQEPYKCDECGKCFTQSGALTTHLRIHTG 326 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 KK YKC +C + L HL + + D+ G S A+ + R H G Sbjct: 131 KKPYKCDECGKCFTRHAQLKAHLVIHSGKKPYECDKCGKCFNQSGALTTHLRTHTG 186 >SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSVAIANYRRRHVGLGCSD 213 +K YKC C + + +L RH+ H + A + ++ FS + RHV GC Sbjct: 661 EKPYKCDVCKKIFGLSSSLSRHIRTVHQDKAFKCERCEKKFSQ---PYHLTRHV-KGCHK 716 Query: 214 ER 215 E+ Sbjct: 717 EK 718 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query: 139 LGAERERAIRDPRYTKKSYKCQKCIISYDHAINLDRHLTLSHNEVALR 186 L + R IR + K++KC++C + +L RH+ H E A++ Sbjct: 675 LSSSLSRHIRTV-HQDKAFKCERCEKKFSQPYHLTRHVKGCHKEKAMK 721 >SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 587 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSVA-IANYRRRH 206 + +Y CQ C ++ NLD+HL L E + Q F++ + +A++ R H Sbjct: 444 RNAYVCQTCDKTFSSKSNLDQHLKLHTGERPYQCTQCEKGFNAKSHLADHLRTH 497 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/35 (31%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 152 YTKKSYKCQKCIISYDHAINLDRHLTLSHNEVALR 186 +T+K Y+C+ C +S+ + L++H L+H + + R Sbjct: 411 FTEKPYQCESCSMSFPRSSCLNKH-RLTHMDTSER 444 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Query: 139 LGAERERAIRDPRYTKKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLF-SSV 197 + + R R +R + K Y C +C S+ + +L RHL E R ++ F SS Sbjct: 332 VSSNRARHMRSHKNIKP-YSCSQCEWSFTTSSDLKRHLKTHTGEKPYRCEECDKAFSSSC 390 Query: 198 AIANYRRRHVGL 209 ++ +++ H + Sbjct: 391 GLSTHKKIHFNI 402 >SB_33309| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 646 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Query: 152 YTK-KSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 +TK K YKC +C ++ HA +L H+ E + Q G + + + + R H G Sbjct: 383 HTKYKPYKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAFARASVLTRHMRTHSG 441 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNE 182 +K +KC +C ++ HA NL +H+ + E Sbjct: 582 EKPHKCTQCGKAFVHASNLTKHMRIHSGE 610 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVGLGCS 212 ++ +KC C SY NL HL + N+ G S F ++ N++ +V Sbjct: 643 QEKWKCNWCEKSYTRKSNLTAHLKMHKNKKPFSCKACGKSFFYESSLVNHKCMNVSSTDK 702 Query: 213 DERL 216 DE + Sbjct: 703 DESI 706 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSVAIANYRRRH 206 K+ Y+CQ+C SY L+ H SH V + G S SS + + RRH Sbjct: 210 KRPYQCQECGKSYRLRSELNYH-ERSHKCVFPCKECGKSFRSSYLLEVHLRRH 261 >SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 615 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 155 KSYKCQKCIISYDHAINLDRHLTLSHNE 182 + + C++C + AI L RHL LSH E Sbjct: 579 EKFVCEQCDKKFITAIQLKRHLWLSHEE 606 >SB_48438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 29.1 bits (62), Expect = 3.4 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 147 IRDP-RYTKKSYKCQKCIISYDHAINLDRH 175 +RDP RY + Y C C S+ ++L++H Sbjct: 290 VRDPARYARSLYTCGVCFKSFKSRVSLEQH 319 >SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 KK YKC +C + L HL + + D+ G S A+ + R H G Sbjct: 131 KKPYKCDECGKCFTRHAQLKAHLVIHSGKKPYECDKCGKCFNQSGALTTHLRTHTG 186 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 KK YKC +C + + L RHL + E + D G S + + R H G Sbjct: 271 KKPYKCDECGNCFSESGKLKRHLMIHTGEKPHKCDDCGKRFTQSGDLKTHLRIHTG 326 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 29.1 bits (62), Expect = 3.4 Identities = 8/31 (25%), Positives = 20/31 (64%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVA 184 +K+Y+C C + + ++ RH+ ++H ++A Sbjct: 447 EKAYQCDHCDMRFSRTNDVTRHVQVAHTDIA 477 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/51 (27%), Positives = 25/51 (49%) Query: 131 VIELSDAELGAERERAIRDPRYTKKSYKCQKCIISYDHAINLDRHLTLSHN 181 V++ + AE++ A +KK Y+C +C ++ +L RH HN Sbjct: 62 VVDDIQKQANAEQQMADDVTACSKKIYQCDQCSKTFTRPHDLRRHTKSIHN 112 >SB_50428| Best HMM Match : zf-C2H2 (HMM E-Value=2e-16) Length = 66 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/29 (34%), Positives = 18/29 (62%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNE 182 +K Y+C+ C +++H+ NL H+ L E Sbjct: 2 EKPYQCEYCHQAFNHSSNLKNHMRLHTGE 30 >SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 426 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSVAIANYRRRHV 207 +K YKC +C + H+ L+ HL + + + D+ FS A R+HV Sbjct: 200 QKPYKCHECGKCFTHSGALNSHLRIHTGQKPYKCDECDKCFSE---AGSLRKHV 250 >SB_43175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVA 184 +K+YKC +C ++ + NL HLT+ + A Sbjct: 196 QKTYKCDECGECFNQSRNLKTHLTIHSGQKA 226 >SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 927 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/42 (28%), Positives = 20/42 (47%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFS 195 +K YKC +C + + NL +HL + R D+ F+ Sbjct: 240 QKPYKCDECGKCFSESGNLKKHLVIHSRRKPYRCDECCECFT 281 >SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1239 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Query: 151 RYTKKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 R + S+KC KC +++ L H+ +H++ + DQ G S S ++A + H G Sbjct: 1107 RLHEGSFKCPKCPMTFPRRSRLAVHVR-THSDKVFQCDQCGKSFRHSRSLARHELLHSG 1164 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSV-AIANYRRRHVG 208 KK +KC C ++ NL HL + E + F+ ++A +RR H G Sbjct: 759 KKEHKCDTCGKQFNSFANLKGHLRIHTGEKPYTCEFCQRSFTEYSSLAKHRRAHTG 814 >SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSVAIANYRRRHV 207 +K YKC +C + H+ L+ HL + + + D+ FS A R+HV Sbjct: 165 QKPYKCHECGKCFTHSGALNSHLRIHTGQKPYKCDECDKCFSE---AGSLRKHV 215 >SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 322 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 153 TKKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 ++K YKC +C + ++ + L RHL + + + D+ G + ++R H G Sbjct: 46 SEKPYKCDECGMGFNQSGALKRHLRIHSGQKPYKCDECGKCCTLHTHLKTHQRIHSG 102 >SB_17147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 28.7 bits (61), Expect = 4.5 Identities = 23/59 (38%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Query: 62 EPEDVEVKEVVAENTPEVND---FYNETAEFPEAQGCEEMKEDGWNLELVGGREEMKKD 117 E E+VE+K E T E ND YNE E +G EE + N E G EE + D Sbjct: 379 EEEEVEIKRGYGEETGEENDKEAGYNEKEEVDIERGYEEETGEE-NDEEAGYDEEEEVD 436 >SB_42412| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-33) Length = 644 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGV 191 +K YKC +C + A L++H L E +L + V Sbjct: 407 EKPYKCSECDRGFKQASQLNQHYRLHTGEKPYKLSEAV 444 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Query: 59 VKIEPEDVEVKEVVAENTPEVNDFYNET--AEFPEAQGCEEMKEDGWNLELVGGREEMKK 116 V++E E + E + E+ F E+ E PE QG E K+D + + ++E+ + Sbjct: 3473 VRLEEEWQNLNEQANDKRKELKSFLGESDEQEMPEDQGDPEKKKDNGKVNMPEFKKELAR 3532 Query: 117 D 117 + Sbjct: 3533 N 3533 >SB_9023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 +K YKC +C ++ A NL H+ E + Q G + + + + R H G Sbjct: 515 EKPYKCTQCGKAFARAFNLTTHMRTHSGEKPYKCTQCGKAFAWAFNLTTHMRTHSG 570 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQ-GVSLFSSVAIANYRRRHVG 208 +K YKC +C ++ A NL H+ E + Q G + + + + R H G Sbjct: 543 EKPYKCTQCGKAFAWAFNLTTHMRTHSGEKPYKCTQCGKAFAHNGVLTTHMRTHSG 598 >SB_21206| Best HMM Match : PaREP8 (HMM E-Value=2.4) Length = 589 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/47 (25%), Positives = 25/47 (53%) Query: 57 CEVKIEPEDVEVKEVVAENTPEVNDFYNETAEFPEAQGCEEMKEDGW 103 C++K++ ED E E A+NT ++ Y+ + + + +KE + Sbjct: 524 CKLKLKEEDSEFSETNADNTQLHSNLYHMIRDDTTPEALQRIKESNF 570 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 155 KSYKCQKCIISYDHAINLDRHLTLSHN 181 K Y C++C + A NL +HL HN Sbjct: 548 KPYACEQCDACFAQAGNLKKHLNRWHN 574 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 156 SYKCQKCIISYDHAINLDRHLTLSHNE 182 ++KC C + A+NL+RH+ L HN+ Sbjct: 562 AFKCNTCDKRFCSAVNLNRHM-LCHNQ 587 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 148 RDPRYTKKSYKCQKCIISYDHAINLDRHLTLSHN 181 R P+ T YKC KC SY + +H+ HN Sbjct: 2588 RSPQ-TPIEYKCNKCSNSYVSFSEMKKHMRTVHN 2620 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 148 RDPRYTKKSYKCQKCIISYDHAINLDRHLTLSHN 181 R P+ T YKC KC SY + +H+ HN Sbjct: 2786 RSPQ-TPIEYKCNKCSNSYVSFSEMKKHMRTVHN 2818 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Query: 153 TKKSYKCQKCIISYDHAINLDRHLTLSHN 181 T YKC KC SY + +H++ HN Sbjct: 3092 TPIEYKCNKCSNSYVSFSEMKKHMSTVHN 3120 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Query: 153 TKKSYKCQKCIISYDHAINLDRHLTLSHN 181 T YKC KC SY + +H++ HN Sbjct: 4223 TPIEYKCNKCSNSYVSFSEMKKHMSTVHN 4251 >SB_18177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/29 (37%), Positives = 20/29 (68%) Query: 10 LLKKTDLFLKRVEQCCSILQGKTSQFKKV 38 LL++T+L LK+ ++ C + T+Q K+V Sbjct: 75 LLRETNLTLKKTDEICRASKSPTAQMKEV 103 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,374,425 Number of Sequences: 59808 Number of extensions: 271727 Number of successful extensions: 1115 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 18 Number of HSP's that attempted gapping in prelim test: 905 Number of HSP's gapped (non-prelim): 234 length of query: 240 length of database: 16,821,457 effective HSP length: 80 effective length of query: 160 effective length of database: 12,036,817 effective search space: 1925890720 effective search space used: 1925890720 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -