BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001660-TA|BGIBMGA001660-PA|IPR007087|Zinc finger, C2H2-type (240 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 27 0.65 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.1 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 26.6 bits (56), Expect = 0.65 Identities = 10/28 (35%), Positives = 15/28 (53%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHN 181 +K YKC +C ++ L RH+ HN Sbjct: 380 QKPYKCDQCAQTFRQKQLLKRHMNYYHN 407 Score = 25.0 bits (52), Expect = 2.0 Identities = 15/67 (22%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 154 KKSYKCQKCIISYDHAINLDRHLTLSHNEVALRLDQGVSLFSSVAIANYRRRHVGLGCSD 213 +K Y+C+ C + +L+ HL L ++ + DQ F + +RH+ + Sbjct: 352 EKCYRCEYCPYASISMRHLESHLLLHTDQKPYKCDQCAQTFRQKQLL---KRHMNYYHNP 408 Query: 214 ERLSLTP 220 + ++ TP Sbjct: 409 DYVAPTP 415 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.1 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 8/54 (14%) Query: 59 VKIEPEDVEVKEVVAENTPEVNDFYNETAEFPEAQGCEEMKEDGWNLELVGGRE 112 +KI+P+ +EV V E+ F N A P + NLE+VGGR+ Sbjct: 350 IKIDPDRLEVFSTV----KEITGFINIQAHHPNFTTLNYFR----NLEVVGGRQ 395 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,340 Number of Sequences: 2123 Number of extensions: 8369 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 4 length of query: 240 length of database: 516,269 effective HSP length: 62 effective length of query: 178 effective length of database: 384,643 effective search space: 68466454 effective search space used: 68466454 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -