BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001659-TA|BGIBMGA001659-PA|IPR007087|Zinc finger, C2H2-type (157 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) 42 3e-04 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 41 4e-04 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_31268| Best HMM Match : zf-C2H2 (HMM E-Value=5.04467e-44) 37 0.007 SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) 37 0.009 SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0) 37 0.009 SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) 36 0.012 SB_43175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.012 SB_3592| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.012 SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.012 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 36 0.015 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 36 0.020 SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) 36 0.020 SB_10554| Best HMM Match : zf-C2H2 (HMM E-Value=0) 35 0.036 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 35 0.036 SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) 35 0.036 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.036 SB_17939| Best HMM Match : zf-C2H2 (HMM E-Value=1e-22) 35 0.036 SB_2816| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.036 SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.047 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 34 0.047 SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.047 SB_20597| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.047 SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.047 SB_8254| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.047 SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.062 SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.062 SB_28163| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.062 SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.082 SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.11 SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) 33 0.14 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_32401| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-10) 33 0.14 SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_59303| Best HMM Match : zf-C2H2 (HMM E-Value=0.71) 32 0.19 SB_50411| Best HMM Match : zf-C2H2 (HMM E-Value=1.3e-08) 32 0.19 SB_42412| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-33) 32 0.19 SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.19 SB_27651| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.19 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.25 SB_52567| Best HMM Match : zf-C2H2 (HMM E-Value=0) 32 0.25 SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_24547| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-18) 32 0.25 SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_11678| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_45463| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.44 SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.44 SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) 31 0.44 SB_19065| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.44 SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) 31 0.58 SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.58 SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.58 SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41) 31 0.58 SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 0.77 SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) 30 0.77 SB_2814| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_44860| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 0.77 SB_22835| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 0.77 SB_53535| Best HMM Match : zf-C2H2 (HMM E-Value=4.8e-32) 30 1.0 SB_29933| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.0 SB_21061| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 1.3 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.3 SB_50303| Best HMM Match : zf-C2H2 (HMM E-Value=1.6e-25) 29 1.8 SB_49724| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_37204| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-25) 29 1.8 SB_28304| Best HMM Match : zf-C2H2 (HMM E-Value=2.8026e-45) 29 1.8 SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.8 SB_13064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_52925| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.3 SB_50428| Best HMM Match : zf-C2H2 (HMM E-Value=2e-16) 29 2.3 SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.3 SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.3 SB_52786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_42825| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_41062| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) 29 2.3 SB_6685| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) 29 2.3 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) 28 3.1 SB_53497| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 3.1 SB_51466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_15832| Best HMM Match : zf-C2H2 (HMM E-Value=7e-35) 28 3.1 SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_14469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 28 4.1 SB_49805| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-12) 28 4.1 SB_389| Best HMM Match : zf-C2H2 (HMM E-Value=1.8e-29) 28 4.1 SB_40645| Best HMM Match : zf-C2H2 (HMM E-Value=3.30006e-42) 27 5.4 SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 5.4 SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_49827| Best HMM Match : zf-C2H2 (HMM E-Value=7e-07) 27 5.4 SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) 27 7.2 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 27 7.2 SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_44864| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_43891| Best HMM Match : zf-C2H2 (HMM E-Value=3e-30) 27 7.2 SB_29493| Best HMM Match : PH (HMM E-Value=0.48) 27 7.2 SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) 27 7.2 SB_22532| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_48462| Best HMM Match : zf-C2H2 (HMM E-Value=1.1e-18) 27 9.5 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_21766| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-15) 27 9.5 SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 27 9.5 SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_27714| Best HMM Match : AA_permease (HMM E-Value=0.29) 27 9.5 SB_26290| Best HMM Match : zf-C2H2 (HMM E-Value=5.5e-08) 27 9.5 SB_17045| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_4758| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_9634| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 587 Score = 41.5 bits (93), Expect = 3e-04 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+CE C + + + L +H R H+ + VC+ C TF+ K + H + H Sbjct: 415 PYQCESCSMSFPRSSCLNKH-RLTHMDTSERNAYVCQTCDKTFSSKSNLDQHLKLH 469 Score = 33.1 bits (72), Expect = 0.11 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Query: 96 LRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 L PYKC+ C +K K +L +K A C IC + K + H+++ Sbjct: 528 LERPYKCDQC----DKKFVRKDYLSTHRLKHSKAKTHYCAICDKYYGQKSNLNTHNKK 581 Score = 32.7 bits (71), Expect = 0.14 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 + Y C C + VF H ERH K +A V C CK F+DK H+ Sbjct: 159 ITYMCTTC-----EKVFKSSHQLERH-KSTHARVYKCPHCKKVFSDKEKRKDHY 206 Score = 30.7 bits (66), Expect = 0.58 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 +KCE C +NK LK H +R A C+ C TF V H+R H Sbjct: 273 HKCEVCSRVFNKCSNLKAHALSHSHERPYA----CDKCDKTFQRTSQLVIHNRIH 323 Score = 29.1 bits (62), Expect = 1.8 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 PY+C C G+N L HLR R A C C+ F S H R Sbjct: 474 PYQCTQCEKGFNAKSHLADHLRTHSQDRPFA----CNECEKKFKHPVSLNKHVR 523 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/52 (28%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Query: 96 LRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSY 147 L PY+CE C + + L RHL H+ VC C K + Sbjct: 353 LEKPYQCEICSKSFTRKDCLNRHLM-THVDPSMRKKHVCLECVKVLPSKSGF 403 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 41.1 bits (92), Expect = 4e-04 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+ CE C V + L +H+R RH N D C C TF + + H R H Sbjct: 357 PFACEQCGVTFANRSNLSKHIRRRH-SDPNVDQNTCGTCYQTFENTLELMQHRRSH 411 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 5/54 (9%) Query: 101 KCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 KC C + V+ +H HI+ N D C C F+ + H R+H Sbjct: 119 KCHIC-----EKVYSNKHYLRDHIRTHNPDGFKCPECGKNFSSGSNLRKHVRKH 167 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 39.1 bits (87), Expect = 0.002 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Query: 101 KCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 KC+ C G+ K FL RHL+E K+ + C+ C TF + H RRH Sbjct: 540 KCDQCGKGFLKKSFLTRHLKEHAGKKAHQ----CKECGKTFKSSTTLKLHKRRH 589 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KCE C G+ K L HL KR C+ C ++ + H R H Sbjct: 184 PFKCEQCDKGFLKKSSLTYHLTLHTGKRP----YQCQECGKSYRLRSELNYHERSH 235 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/48 (33%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Query: 94 NYLRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTF 141 N+ + KC+ C N+ V KR LR K CE CK F Sbjct: 343 NHSNVLLKCDSC----NEMVTGKRALRNHMKKVHQTTTTKCEFCKKEF 386 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C ++ + L + +K VCE+C +F RS V H H Sbjct: 591 PYKCQEC----GQEFARQSQLNDHRLKHTGETPFVCEVCSKSFTTSRSMVRHMLTH 642 Score = 33.5 bits (73), Expect = 0.082 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 YKC++C + + LK HL +R C C +++ RS V H R H Sbjct: 733 YKCQECDKKFRRISGLKDHLLTHRGERP----FQCSTCSKSYSTSRSLVRHERSH 783 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/56 (25%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC C Y + L H+ + + C +C F+ + H R H Sbjct: 674 PYKCNVCDKSYTRQKMLTDHMYSH--EESGTKIYRCVLCDDVFDQIKELTKHQRTH 727 Score = 30.7 bits (66), Expect = 0.58 Identities = 15/56 (26%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C+ C + L RHL ++ + C +C F V H R H Sbjct: 1007 PYHCKKCDKRFAHSTVLLRHL----YSHKDGKPMCCHLCSEAFTKALKAVEHQRTH 1058 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C+ C G+ + + RH R H ++ C C F + H H Sbjct: 535 PYRCDLCTKGFKRRSCMTRH-RALHTEKR---PFKCPNCSKAFKTSYALTSHQVTH 586 >SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 37.5 bits (83), Expect = 0.005 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 5/56 (8%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C +C + LK+H I R NA C +CK ++ D +S H R H Sbjct: 242 PYTCNNCQKTFKTKCDLKQH-----ISRHNAGKHQCNVCKKSYADLKSLEDHLRSH 292 Score = 36.3 bits (80), Expect = 0.012 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+ CE C G+N RHLR H N C C+ TF K H RH Sbjct: 213 PFLCEVCGQGFNCHANRNRHLRTVH---SNIRPYTCNNCQKTFKTKCDLKQHISRH 265 >SB_31268| Best HMM Match : zf-C2H2 (HMM E-Value=5.04467e-44) Length = 454 Score = 37.1 bits (82), Expect = 0.007 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKCE C G++ +K H+R ++ C IC F D+ + H R H Sbjct: 365 PYKCEVCERGFSHSSAVKNHMRTHTGEKP----FQCPICNKKFADQSTVKKHERTH 416 >SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 928 Score = 36.7 bits (81), Expect = 0.009 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKCE C G+ + L HL KR C C TF + + + H RRH Sbjct: 703 PYKCEICNKGFVQSSALSSHLLTHSGKRP----YECLTCGQTFRSRSNLLYHERRH 754 Score = 35.9 bits (79), Expect = 0.015 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C + L RH++ H+K+ C+ CK F + + H H Sbjct: 871 PFKCDTCEKAFRSSSELTRHVKLVHVKKP----FPCDTCKQAFRSEDALARHKNTH 922 Score = 33.5 bits (73), Expect = 0.082 Identities = 17/56 (30%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C C + L +H R H C+IC F+D+ V H R H Sbjct: 590 PYVCTKCNKAFAYSASLVKHDRVYH---RGVKPYECDICGRAFSDRSGLVKHERTH 642 Score = 31.9 bits (69), Expect = 0.25 Identities = 19/56 (33%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKCE C ++ LK HLR +R CEIC F + H H Sbjct: 675 PYKCEYCSAAFSVSDTLKSHLRLHTGERP----YKCEICNKGFVQSSALSSHLLTH 726 Score = 31.5 bits (68), Expect = 0.33 Identities = 19/56 (33%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC+ C G+ LK H R RH + CE C F H R H Sbjct: 787 PYKCQVCERGFACTSALKSHQR-RH---DGIKPYKCERCDKRFTSSNERTRHMRTH 838 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P++C C + ++ L RH+R +R CE C + F+ + H R H Sbjct: 647 PFECSFCHMMFSLKGLLTRHMRSHTGQRP----YKCEYCSAAFSVSDTLKSHLRLH 698 >SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 322 Score = 36.7 bits (81), Expect = 0.009 Identities = 14/27 (51%), Positives = 19/27 (70%) Query: 94 NYLRLPYKCEDCIVGYNKDVFLKRHLR 120 N PYKC++C +G+N+ LKRHLR Sbjct: 44 NLSEKPYKCDECGMGFNQSGALKRHLR 70 Score = 29.9 bits (64), Expect = 1.0 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 8/61 (13%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFND----KRSYVPHHR 152 R PY+C++C Y K LKRHL H +++ C+ C F++ KR + H R Sbjct: 121 RKPYQCDECGKCYIKFGALKRHL-SIHTEQK---PYKCDKCGKGFSESGALKRHVIIHSR 176 Query: 153 R 153 R Sbjct: 177 R 177 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 PYKC+ C G+++ LKRH+ I C+ C F + + H +RH + Sbjct: 151 PYKCDKCGKGFSESGALKRHV----IIHSRRKPYKCDECGKCF----TQLTHVKRHLM 200 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKCE+C + + LKRHL Sbjct: 207 PYKCEECGKCFTQLTHLKRHL 227 Score = 27.9 bits (59), Expect = 4.1 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 R PYKC++C + + +KRHL H+ ++ CE C F + + H +RH + Sbjct: 177 RKPYKCDECGKCFTQLTHVKRHLM-IHLGQK---PYKCEECGKCF----TQLTHLKRHLM 228 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKCE+C + ++ LK HL Sbjct: 291 PYKCEECGKCFTQNAHLKTHL 311 >SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 426 Score = 36.3 bits (80), Expect = 0.012 Identities = 16/56 (28%), Positives = 24/56 (42%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ LK HL+ + C++C F H R H Sbjct: 258 PYKCDECGKCFNQSGNLKTHLKAHLMMHSGQKPYKCDVCDKGFTRHAGLKSHLRIH 313 Score = 35.5 bits (78), Expect = 0.020 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC +C YN LKRHLR + C++C F + H R H Sbjct: 90 PYKCNECGKCYNLSSSLKRHLR----THSEQNPYKCDVCGKCFTYSGALKTHLRIH 141 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC +C + L HLR H ++ C+ C S R +V H H Sbjct: 202 PYKCHECGKCFTHSGALNSHLR-IHTGQKPYKCDECDKCFSEAGSLRKHVLIHSGH 256 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 R PYKC +C +++ +LK HL + C+ C F S H + H Sbjct: 372 RKPYKCYECGKCFSRHRYLKTHL----MIHSGQKPYKCDECGKCFTRSGSLKTHVKTH 425 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 PYKC++C +++ L++H+ + C+ C FN + H + H + Sbjct: 230 PYKCDECDKCFSEAGSLRKHV----LIHSGHKPYKCDECGKCFNQSGNLKTHLKAHLM 283 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ LK HL + C+ C F K + H H Sbjct: 318 PYKCDECGKCFNQSGTLKTHL----MIHSGQKPYKCDECGKCFTVKSNLKTHLMIH 369 >SB_43175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 36.3 bits (80), Expect = 0.012 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC+ C G+ LKRHLR ++ C+ C FN R+ H H Sbjct: 170 PYKCDVCDKGFTWHSVLKRHLRMHSAQK----TYKCDECGECFNQSRNLKTHLTIH 221 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC++C + + FL +H+R H + C+ C FN + H R H Sbjct: 86 PHKCDECGKCFTESRFLNKHVR-IHTGHK---PFKCDECGKCFNQSENLKTHLRIH 137 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C +N+ LK HL ++ + C+ C F + R H R H Sbjct: 58 PHKCDKCGKCFNRPSRLKTHLMIHSGQKPHK----CDECGKCFTESRFLNKHVRIH 109 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC++C +N+ LK HLR ++ C+ C FN H H Sbjct: 114 PFKCDECGKCFNQSENLKTHLRIHSGQKP----YKCDECGRCFNRSGHLKTHLMMH 165 >SB_3592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 36.3 bits (80), Expect = 0.012 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC +C YN+ LKRHLR H ++ C+ C FN + H R H Sbjct: 129 PYKCNECGKCYNQTSSLKRHLR-THTGQK---PYKCDECGKCFNQSGALNSHLRIH 180 Score = 31.1 bits (67), Expect = 0.44 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ L HLR H ++ C+ C S R ++ H H Sbjct: 185 PYKCDECGKCFNQSGALNSHLR-IHSGQKPYKCDECDKCFSEAGSLRKHLMIHSGH 239 Score = 31.1 bits (67), Expect = 0.44 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC++C +N+ LK+HL + C+ C FN S H + H Sbjct: 241 PHKCDECGKCFNQSGNLKKHL----MIHSGQKPYKCDECGKCFNQSGSLKTHAKTH 292 >SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 36.3 bits (80), Expect = 0.012 Identities = 16/56 (28%), Positives = 24/56 (42%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ LK HL+ + C++C F H R H Sbjct: 223 PYKCDECGKCFNQSGNLKTHLKAHLMMHSGQKPYKCDVCDKGFTRHAGLKSHLRIH 278 Score = 35.5 bits (78), Expect = 0.020 Identities = 19/56 (33%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC +C YN LKRHLR + C++C F + H R H Sbjct: 55 PYKCNECGKCYNLSSSLKRHLR----THSEQNPYKCDVCGKCFTYSGALKTHLRIH 106 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC +C + L HLR H ++ C+ C S R +V H H Sbjct: 167 PYKCHECGKCFTHSGALNSHLR-IHTGQKPYKCDECDKCFSEAGSLRKHVLIHSGH 221 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 R PYKC +C +++ +LK HL + C+ C F S H + H Sbjct: 337 RKPYKCYECGKCFSRHRYLKTHL----MIHSGQKPYKCDECGKCFTRSGSLKTHVKTH 390 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 PYKC++C +++ L++H+ + C+ C FN + H + H + Sbjct: 195 PYKCDECDKCFSEAGSLRKHV----LIHSGHKPYKCDECGKCFNQSGNLKTHLKAHLM 248 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ LK HL + C+ C F K + H H Sbjct: 283 PYKCDECGKCFNQSGTLKTHL----MIHSGQKPYKCDECGKCFTVKSNLKTHLMIH 334 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 35.9 bits (79), Expect = 0.015 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 Y CE C G+++ K H R H K + C C TF++++S + HHR Sbjct: 913 YTCEVCDKGFSRVSSYKTHFRY-HSK--DTLTFKCSHCNETFSNRQSLIEHHR 962 Score = 32.7 bits (71), Expect = 0.14 Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C C + +L H++ + VC +C F K + + H +H Sbjct: 477 PYTCSQCDKAFKAPHYLALHMKSHSMANVT---FVCSVCDKEFRSKTALINHQVKH 529 Score = 30.7 bits (66), Expect = 0.58 Identities = 14/53 (26%), Positives = 22/53 (41%) Query: 102 CEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 C C ++ L H+ K++ + CE+C F+ SY H R H Sbjct: 883 CASCKETFDSRENLDAHVNAGCPKKKPQETYTCEVCDKGFSRVSSYKTHFRYH 935 Score = 29.9 bits (64), Expect = 1.0 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 R Y C+ C +++ K H R H K ++ C C TF++++S + H R Sbjct: 1027 REAYTCQVCDKAFSRVSSYKTHFRY-HSK--DSLTFKCSHCNETFSNRQSLIKHQR 1079 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 6/51 (11%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPH 150 +KCE C +LKRHL H + + C CK TF+ + + H Sbjct: 855 FKCEQCDKSLLSQYYLKRHLL-THTRSPS-----CASCKETFDSRENLDAH 899 Score = 27.9 bits (59), Expect = 4.1 Identities = 13/56 (23%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 101 KCEDCIVGYNKDVFLKRHLRERHIKR--ENADVIVCEICKSTFNDKRSYVPHHRRH 154 +C C ++ LK+H ++ + + C++C F+ SY H R H Sbjct: 997 RCSSCKETFDSKENLKQHSSAGCPEKSSQEREAYTCQVCDKAFSRVSSYKTHFRYH 1052 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 101 KCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 KC+ C ++ LK H + H K + VC C F+ + Y H R H Sbjct: 1257 KCKICDKSFSHIGALKAHAKT-HGKSVGENT-VCVTCSQVFSSLQEYQEHARSH 1308 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 101 KCEDCIVGYNKDVFLKRHLRERHIKR--ENADVIVCEICKSTFNDKRSYVPHHRRH 154 +C C ++ LK+H ++ + + CE+C F+ SY H R H Sbjct: 1114 RCPSCKETFDSKENLKQHSSAGCPEKSSQKKEEYTCEVCDKVFSRVSSYKTHVRFH 1169 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 35.5 bits (78), Expect = 0.020 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC+ C+ +N L RH+R ++ C+ C F+ + + + H R H Sbjct: 931 PYKCQYCVRSFNDSQMLVRHIRSHTGEKP----FKCKHCSMAFSKQSALIIHTRVH 982 Score = 34.7 bits (76), Expect = 0.036 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KCE C ++ + +++HL + C+ C +FND + V H R H Sbjct: 903 PFKCEYCGRAFSDSLSIEKHL----LVHTGTKPYKCQYCVRSFNDSQMLVRHIRSH 954 Score = 31.1 bits (67), Expect = 0.44 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPH 150 YKC C G+N + L++H+ CE C F+D S H Sbjct: 876 YKCNFCGKGFNDKIVLEKHI----YSHTGVKPFKCEYCGRAFSDSLSIEKH 922 >SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 35.5 bits (78), Expect = 0.020 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ LK HLR H ++ C+ C +FN + H R H Sbjct: 273 PYKCDECGKCFNQSANLKTHLR-IHTGQKPCK---CDACGKSFNQSGALKRHLRIH 324 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C + + LKRHL + C++C F H R H Sbjct: 77 PYKCDECGKCFTRKTTLKRHL----MIHSGEKPYKCDVCGKCFIQNADLKIHLRIH 128 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C + + LKRHL + C++C F H R H Sbjct: 133 PYKCDECGKCFTRKTTLKRHL----MIHSGEKPYKCDVCGKCFIQNADLKIHLRIH 184 Score = 29.9 bits (64), Expect = 1.0 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC C G+ + L RHLR ++ C+ C F K + H H Sbjct: 385 PYKCNVCDKGFTRHADLNRHLRIHSGQKP----YKCDECGKCFTRKTTLKTHLMIH 436 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C++C + + LK HL + C+ C FN + H R H Sbjct: 245 PYECDECGKCFTRKTHLKAHL----MIHSGEKPYKCDECGKCFNQSANLKTHLRIH 296 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Query: 94 NYLRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 N PY+C++C +G+ + L HLR H+ ++ C+ C F K + H Sbjct: 44 NLSEKPYECDECGMGFTQSGALGSHLR-IHLGQK---PYKCDECGKCFTRKTTLKRHLMI 99 Query: 154 H 154 H Sbjct: 100 H 100 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ +K HL + C +C F + H R H Sbjct: 189 PYKCDECGKCFNQSGEVKIHL----MTHSGQKPYKCNVCDKCFTHLGALKTHLRIH 240 >SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 336 Score = 35.5 bits (78), Expect = 0.020 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KCE C +N+ LK H+R E A VC+IC F+ K + H H Sbjct: 223 PHKCEVCNKSFNRSSTLKTHVRTH--SEEKA--FVCDICGKGFHQKGNLRNHIMIH 274 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 4/53 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 P++C C +NK LK H+ H +N C+ C+ F K H+ Sbjct: 279 PFQCTKCHRAFNKMSNLKFHM---HTHTDNLP-YQCKTCRKKFEKKTDLKQHN 327 >SB_10554| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 194 Score = 34.7 bits (76), Expect = 0.036 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Query: 94 NYLRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 N PY+C +C +G+ + +LKRHLR ++ C+ C F + H R Sbjct: 41 NLSEKPYECGECGMGFTRHAYLKRHLRIHSGQKPYR----CDECGKGFTQSGALNRHLRI 96 Query: 154 H 154 H Sbjct: 97 H 97 Score = 31.5 bits (68), Expect = 0.33 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 PYKC++C +N+ LK HLR H ++ C C + D+++++ H Sbjct: 102 PYKCDECGKCFNQSANLKTHLR-IHSGQKPYKCDECGKCFTRQTDQKTHLRIH 153 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 34.7 bits (76), Expect = 0.036 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P++C C +++D LK HLR H K + C IC F S H R H Sbjct: 398 PFRCPTCQKSFSQDANLKAHLRV-HSKEK---PFKCHICHRRFAQSSSVTTHMRIH 449 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 PYKC+ C G++ L + LR ++ C IC +F+ + H R Sbjct: 454 PYKCKVCARGFSDSSTLTKRLRTHTGEKP----YQCRICGMSFSQSGNLSRHMR 503 >SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 330 Score = 34.7 bits (76), Expect = 0.036 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC C +N+ LK H+R +E +CE+C F+ K + H H Sbjct: 218 PHKCHICNKAFNRSSTLKTHIRTHSEVKE----YICEVCGKGFHQKGNLRNHSLIH 269 Score = 30.3 bits (65), Expect = 0.77 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPH 150 PYKC C +NK LK H+ H+ +N+ C+ CK +F+ + H Sbjct: 274 PYKCALCEKAFNKLSNLKFHM---HVHTDNSP-YRCKYCKVSFSRRCDLKSH 321 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 34.7 bits (76), Expect = 0.036 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 PYKCE C + L RH+R H+ N C+ C F + HH+ Sbjct: 116 PYKCEHCGRYFGLSNVLARHIRNVHV---NGSPFECDQCGRCFKKNETLDHHHQ 166 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/49 (28%), Positives = 23/49 (46%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYV 148 Y+C+ C + L H+R H +++N + C F D RS+V Sbjct: 508 YECDLCDSVFISSADLSNHMRSAHNRKKNYNCGKCGHVFKKFGDLRSHV 556 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 PY+C C + L RH+R H + + C C+ +F H R Sbjct: 174 PYQCTQCDKLFGSQEILDRHVRAVHNQEK---PFKCSKCEESFGWPMQLTDHTR 224 Score = 26.6 bits (56), Expect = 9.5 Identities = 15/54 (27%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 P+KC C + + L H R H + + C C FN R + H R Sbjct: 203 PFKCSKCEESFGWPMQLTDHTRNTHAQVYTSK--ECPQCGKVFNRGRDTLRHIR 254 >SB_17939| Best HMM Match : zf-C2H2 (HMM E-Value=1e-22) Length = 203 Score = 34.7 bits (76), Expect = 0.036 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C G+ + L HLR + + C+ C FN K + H RH Sbjct: 104 PHKCDKCGCGFKQLTHLTYHLR----THSDVRMFTCQYCGKGFNQKGNLQAHVYRH 155 >SB_2816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 503 Score = 34.7 bits (76), Expect = 0.036 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIK------RENAD-VIVCEICKSTFNDKRSYVPH- 150 P+KC+ C + + L+ HL H RE D + VCE C TF D ++ H Sbjct: 420 PFKCDRCDKAFTQRCSLEAHLTRVHSVVHKYGFRERRDKMFVCEDCGITFKDSPEFMKHV 479 Query: 151 HRRH 154 H H Sbjct: 480 HELH 483 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 YKCE C ++ L RH++ + C+ C FND H R H Sbjct: 365 YKCEICQSSFSLQRLLNRHMKTHSFYKR----YHCQFCGKGFNDTFDLKRHIRTH 415 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/54 (29%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 Y C+ C G+N LKRH+R C+ C F + S H R Sbjct: 393 YHCQFCGKGFNDTFDLKRHIR----THTGIKPFKCDRCDKAFTQRCSLEAHLTR 442 >SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 907 Score = 34.3 bits (75), Expect = 0.047 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 4/43 (9%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTF 141 PYKC C ++ LKRH R H K + VCEIC F Sbjct: 146 PYKCSHCSKAFSDASILKRHTR-THTKEK---PYVCEICGKAF 184 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 P++CE C + RH+R N + C++C+ F D+ H +R Sbjct: 235 PFQCEHCPKAFTSSSNCSRHMR----IHTNERLFQCDLCEKAFIDRADLRRHCQR 285 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 34.3 bits (75), Expect = 0.047 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query: 8 KSSPNDTDVKVESDSSDLETALPLSQIKEKKRKNAVRGMCAIKKTKTEMTSDASPY 63 KS N T K+++DSSD+ET + + KEKKRK R KT ++ + + Sbjct: 861 KSHKNKTRNKIDTDSSDVETGRHVKR-KEKKRKEKKRRREKDSSEKTRVSKSSKNF 915 >SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 487 Score = 34.3 bits (75), Expect = 0.047 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 +KCE C K+ L +HL+ H+ C +C F+ + S H R H Sbjct: 319 HKCETC----GKEFTLLKHLQRHHLVHTGEKPYKCHLCGRAFSQQGSLQAHSRTH 369 Score = 32.7 bits (71), Expect = 0.14 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKCE+C + + LKRH R R C +C +F + + V H R H Sbjct: 430 PYKCEECGKTFTQTNDLKRHSRIHTGIRP----YKCHVCSKSFTVEFTLVCHLRTH 481 >SB_20597| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 268 Score = 34.3 bits (75), Expect = 0.047 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 + C+ C+ ++K++ L H KR + CE C TF+ S+ H R+H Sbjct: 219 WSCDQCMRTFSKNIQLVSH------KRSHLPKYTCETCGETFSKLSSFKSHGRKH 267 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC C G+ L +H R +R C +C F + H+R H Sbjct: 77 PHKCSICEKGFKTKRCLTKHFRTHTGERP----YQCAMCDMAFATLSGRIQHYRSH 128 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY CE C + + L RH+R ++ C C +F K + V H R H Sbjct: 133 PYLCETCGRRFTESRDLARHIRSHTGEKP----YQCMKCGKSFAHKCTLVTHDRIH 184 >SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 539 Score = 34.3 bits (75), Expect = 0.047 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC DC ++ +L+ H R H + + C ICK F+ + + + H R H Sbjct: 436 PFKCTDCDKTFSHSQYLRLH-RRIHTGEKPYE---CTICKKRFSKQGNMITHARIH 487 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKCE C + + L H+R ++ + C C +F K H R H Sbjct: 352 PYKCEHCDKTFARTTCLTVHIRTHTGEKPHK----CTQCGKSFTSKSDLTKHSRVH 403 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 124 IKRENADVIV--CEICKSTFNDKRSYVPHHRRH 154 +K+ D +V C+IC TF S H+RRH Sbjct: 231 LKKTKLDDVVNTCDICHKTFAQAGSLTIHYRRH 263 >SB_8254| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 684 Score = 34.3 bits (75), Expect = 0.047 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 5/43 (11%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTF 141 PYKC+ C Y++ L RH++E +K+ C +C +F Sbjct: 9 PYKCDQCGKCYSRPYNLTRHIKEHEVKQHE-----CPVCGKSF 46 Score = 27.5 bits (58), Expect = 5.4 Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKR 126 P+KC+ C + Y+ KRH+++ + R Sbjct: 310 PFKCDICGMSYSTPGKRKRHMKDHDVNR 337 >SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 366 Score = 33.9 bits (74), Expect = 0.062 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C++C G+ + L RHLR ++ C+ C FN + H R H Sbjct: 173 PYRCDECGKGFTQSGALNRHLRIHSGQKP----YKCDECGKCFNQSANLKTHLRIH 224 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C +C + + LK HLR ++ C++C F++ R+ H H Sbjct: 257 PYECGECGKCFTRSERLKTHLRIHSGQKP----YKCDVCGKCFSESRNLKRHLMIH 308 Score = 28.7 bits (61), Expect = 2.3 Identities = 10/26 (38%), Positives = 16/26 (61%) Query: 94 NYLRLPYKCEDCIVGYNKDVFLKRHL 119 N P +C +C +G+ + +LKRHL Sbjct: 140 NLSEKPNECGECGMGFTRHAYLKRHL 165 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/22 (50%), Positives = 16/22 (72%) Query: 99 PYKCEDCIVGYNKDVFLKRHLR 120 PYKC++C + + V LKRHL+ Sbjct: 229 PYKCDECGKCFIQYVDLKRHLK 250 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC+ C +++ LKRHL + C++C F++ + H H Sbjct: 285 PYKCDVCGKCFSESRNLKRHL----MIHSGQKPYKCDVCGKCFSESGNLKKHLMIH 336 >SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1346 Score = 33.9 bits (74), Expect = 0.062 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTF 141 P+ CE C+ +N+ L+RH H +E A VC+ C F Sbjct: 1196 PFSCEQCMKSFNRSGDLRRHCMTVHEGKERA--FVCKECSVKF 1236 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/56 (23%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERH-IKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 + C++C V + + LKRH H ++C C + F+ + H H Sbjct: 1227 FVCKECSVKFTRAADLKRHCLTAHPTIPSQGKTLICSTCSAAFSTQICLKIHMDTH 1282 >SB_28163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 33.9 bits (74), Expect = 0.062 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C G+ + L HLR + + C+ C FN K + H RH Sbjct: 18 PHKCDKCGRGFKQLTHLTYHLR----THSDVRMFTCQYCGKGFNQKGNLQAHVYRH 69 >SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1741 Score = 33.5 bits (73), Expect = 0.082 Identities = 12/56 (21%), Positives = 25/56 (44%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P++C C G+ L H++ H + +++ C+ C + ++ H RH Sbjct: 1493 PHQCIVCRKGFTARSRLLHHVKAHHNMKTKSNIFTCKYCGRAITNHSDFLLHVERH 1548 Score = 31.1 bits (67), Expect = 0.44 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 9/64 (14%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERH-----IKR---ENADVIVCEICKSTFNDKRSYVPH- 150 Y C C + K L RH R H IK EN +C+ C+++F K +V H Sbjct: 883 YCCSICGASFGKSKALSRHHRRIHRGKNIIKSGSTENEGPFMCKTCQNSFEIKGEFVAHI 942 Query: 151 HRRH 154 +++H Sbjct: 943 NKQH 946 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKREN 128 Y C C G++K + LK+H R+ H +R+N Sbjct: 825 YHCNICGAGFSKSLTLKKHQRKTH-RRKN 852 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/34 (29%), Positives = 18/34 (52%) Query: 120 RERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 + + I ++ V C IC ++F ++ HHRR Sbjct: 871 KSKTINPQSISVYCCSICGASFGKSKALSRHHRR 904 >SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 33.1 bits (72), Expect = 0.11 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 +KC+ C + ++ LK H+RE H E C+ C+ F+ R + H R Sbjct: 605 FKCDQCNLLFSWQCSLKSHIREVHKDVEKRS--KCDECQKCFHRHRDLLTHKR 655 Score = 31.5 bits (68), Expect = 0.33 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 7/55 (12%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 ++CE C +N+ LK H+ H+ + CEIC+ F ++ H +RH Sbjct: 518 HQCEHCKKIFNRPHHLKAHVNTTHLGEKR---FKCEICEKCF----GFLTHLKRH 565 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 P+ CE C ++ +LK H++ H +++ + C+ C F+ + S H R Sbjct: 575 PHHCEKCGKCFSSTSYLKLHIKSVHNEKK---LFKCDQCNLLFSWQCSLKSHIR 625 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 4/52 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPH 150 PYKC+ C + L RH+R H + CE C+ F+ H Sbjct: 663 PYKCDVCKKIFGLSSSLSRHIRTVHQDK----AFKCERCEKKFSQPYHLTRH 710 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.1 bits (72), Expect = 0.11 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 PY C C V + D L H+R RH ++ C+ C +TF + S++ H R Sbjct: 831 PYVCNRCGVSFRHDSTLTMHIRTRH---DHLRPFKCDECGNTFG-RLSHLRKHVR 881 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 94 NYLRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENAD--VIVCEICKSTFNDKRSYVPH 150 ++LR P+KC++C + + L++H+R+ R N D + C C+ F K H Sbjct: 856 DHLR-PFKCDECGNTFGRLSHLRKHVRKVCGNRRNKDRPIAQCRFCEENFPTKGDLRKH 913 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Query: 102 CEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 C+ C +KD +LR + + CE+C F +K S H +R Sbjct: 934 CDQC----SKDFASPYNLRRHQLTHTDEKPFQCEVCARQFKEKSSLSKHIKR 981 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 33.1 bits (72), Expect = 0.11 Identities = 24/75 (32%), Positives = 30/75 (40%), Gaps = 18/75 (24%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIV----------------CEI--CKS 139 LP+KCEDC + + +L+RH R N +V CE C Sbjct: 465 LPWKCEDCGLAFKWSSWLQRHQRNNCHGESNKKAVVTVTSKMQAPRSDAPFACERPGCGK 524 Query: 140 TFNDKRSYVPHHRRH 154 F KR Y H RRH Sbjct: 525 AFATKRQYGRHRRRH 539 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERH 123 PY C +C + + LKRH+R H Sbjct: 1237 PYPCPECGLAFKVSDGLKRHMRSLH 1261 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/36 (30%), Positives = 19/36 (52%) Query: 95 YLRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENAD 130 + R Y CE+C + +L RH+RE + E+ + Sbjct: 723 FKRQMYSCEECGKKFAAASWLTRHMREHAARAESVE 758 >SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 32.7 bits (71), Expect = 0.14 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 + C++C ++ ++LKRH + H++ N CEIC + + H R Sbjct: 388 HTCDECGKVFHSQIYLKRH-KTVHVEERN---FPCEICNKAYTSDANLKAHKR 436 Score = 32.3 bits (70), Expect = 0.19 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 123 HIKRENADVIVCEICKSTFNDKRSYVPHHR 152 H + D+ VC CK+TFND Y+ H + Sbjct: 139 HSDDDEFDIHVCGRCKNTFNDLSKYIEHKK 168 Score = 28.3 bits (60), Expect = 3.1 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERH-IKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 + CE C Y D LK H R H I++++ CE C F K H H Sbjct: 416 FPCEICNKAYTSDANLKAHKRSVHCIEKKHK----CEECGKAFARKDKLKRHQLIH 467 >SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1080 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 +KC+ C +N LK HLR ++ CE C+ +F + S H R H Sbjct: 762 HKCDTCGKQFNSFANLKGHLRIHTGEKP----YTCEFCQRSFTEYSSLAKHRRAH 812 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +++ LK H+R ++ C +C+ F + H R H Sbjct: 817 PYKCKECDKAFSQSGGLKVHMRVHTGEKP----YPCPLCERAFAKGYNLKTHMRTH 868 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C C + K LK H+R ++ C+ C F+ + + H +RH Sbjct: 845 PYPCPLCERAFAKGYNLKTHMRTHTGEKPYK----CDFCSKLFSQHSTLMQHVQRH 896 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 +PY+C C L HLR K+E+ C+ C FN + H R H Sbjct: 732 VPYQCHHCPEKLKLRCHLNYHLRIHAPKKEHK----CDTCGKQFNSFANLKGHLRIH 784 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 32.7 bits (71), Expect = 0.14 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P++C C + L RH R ++ CEIC+ +F DK S H R H Sbjct: 516 PHECTQCEKAFITKAKLDRHFRTHSGEKPYR----CEICEKSFRDKDSLNIHMRIH 567 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHF 155 PY C C + LKRHL+ ++ CE C F+ H + HF Sbjct: 348 PYSCSQCEWSFTTSSDLKRHLKTHTGEKPYR----CEECDKAFSSSCGLSTHKKIHF 400 Score = 29.9 bits (64), Expect = 1.0 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC +C ++ L+ H+R +E +C IC+ F + H + H Sbjct: 628 PYKCTNCGRAFSCRSGLREHMRTHGGVKE----FICSICEKAFLRRGCLKKHEKLH 679 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C+ C + + L H R N C++C F S V H+R H Sbjct: 264 PYSCKYCGRMFGESSSLIMHQRIH----TNEKPYKCKLCPKAFTSHSSLVMHNRHH 315 Score = 27.9 bits (59), Expect = 4.1 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC C ++ L H+R RH N VC C +F V H+R H Sbjct: 432 PFKCTYCDKAFSIKGNLTVHIR-RHT---NERPYVCTTCGKSFTVISQLVMHNRSH 483 Score = 26.6 bits (56), Expect = 9.5 Identities = 15/56 (26%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKCE C ++ RH+R +N C C+ +F H + H Sbjct: 320 PYKCEICGRAFSVSSNRARHMR----SHKNIKPYSCSQCEWSFTTSSDLKRHLKTH 371 >SB_32401| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-10) Length = 269 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 ++ YKCE C + + L++HL E H ++ +C +C F D + HH H Sbjct: 195 KMSYKCEVCSQLFRSPLGLQKHL-EFH--TDDGQHYMCTVCFMRFRDISALDAHHLTH 249 >SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 32.7 bits (71), Expect = 0.14 Identities = 13/56 (23%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C C + +L H++ + VC +C F K + + H +H Sbjct: 409 PYTCSQCDKAFKAPHYLALHMKSHSMANVT---FVCSVCDKEFRSKTALINHQVKH 461 >SB_59303| Best HMM Match : zf-C2H2 (HMM E-Value=0.71) Length = 116 Score = 32.3 bits (70), Expect = 0.19 Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 123 HIKRENADVIVCEICKSTFNDKRSYVPHHR 152 H + D+ VC CK+TFND Y+ H + Sbjct: 10 HSDDDEFDIHVCGRCKNTFNDLSKYIEHKK 39 >SB_50411| Best HMM Match : zf-C2H2 (HMM E-Value=1.3e-08) Length = 108 Score = 32.3 bits (70), Expect = 0.19 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 5/61 (8%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 ++ + C+ C + ++ L RH + H R V VCE C+ +FN ++ + H ++ + Sbjct: 35 KMTFVCDTCSKEFTQETNLVRHKKAIHGNR----VFVCERCQKSFN-RKDILKRHEKNTL 89 Query: 157 R 157 + Sbjct: 90 K 90 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEIC 137 + CE C +N+ LKRH + +KR+ + ++ C Sbjct: 66 FVCERCQKSFNRKDILKRH-EKNTLKRKQSPAVIAINC 102 >SB_42412| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-33) Length = 644 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC C G+ + L +HLR +R C++C F H R H Sbjct: 353 PHKCPQCPKGFKQPSHLAQHLRTHTDERP----FNCKVCNKAFKQSCQLKQHMRLH 404 >SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 32.3 bits (70), Expect = 0.19 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C C + LK H+R +R VC+IC+ F H R H Sbjct: 161 PYECTTCGKRFRVSSHLKDHIRVHTGERP----YVCDICQKGFKQSSDLKKHRRTH 212 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/60 (25%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRER--HIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 R +KC+ C + L+ H+R + + C C TF+ + SY H H Sbjct: 804 RFKFKCDVCDKMFRTRSHLRDHVRIHTGQSTKPMRSIFRCNYCFKTFSKEESYRSHCEEH 863 Score = 27.5 bits (58), Expect = 5.4 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 8/56 (14%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C+ C G+ + LK+H R + + C C S F RS+ H R H Sbjct: 189 PYVCDICQKGFKQSSDLKKHRRTHTLDKP----FKCPFCASAFT--RSH--HCRGH 236 >SB_27651| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 280 Score = 32.3 bits (70), Expect = 0.19 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C + + LK HL K +N CE+C+ +F H + H Sbjct: 59 PFKCDMCERWFTQSTSLKTHLCTHDKKPDN---FKCELCEKSFGYSAGLRQHMKYH 111 Score = 29.5 bits (63), Expect = 1.3 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 +KC+ C + LK HL + K+ CE+CK +F H + H Sbjct: 145 FKCDICEKRVTRMTTLKAHLSTHYFKKPAN--FKCELCKRSFGSASGLRQHIKYH 197 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFIR 157 P+KC C + + K L +HLR + C+IC+ + H H+ + Sbjct: 116 PHKCNQCDMEFYKKGDLTKHLR----THSGEKLFKCDICEKRVTRMTTLKAHLSTHYFK 170 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 31.9 bits (69), Expect = 0.25 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C G+ + LK HLR ++ C+ C FN + H R H Sbjct: 477 PFKCDVCDKGFTRHAGLKSHLRIHSGQKP----YKCDECGKCFNQSGTLKSHLRIH 528 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +N+ LK HLR ++ C+ C F K + H H Sbjct: 505 PYKCDECGKCFNQSGTLKSHLRIHSGQKP----YKCDECGKCFTVKSNLKTHLMIH 556 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/56 (25%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C+ C + + LK HL + C++C F H R H Sbjct: 449 PYECDACGKCFTRKTHLKAHL----MMHSGQKPFKCDVCDKGFTRHAGLKSHLRIH 500 >SB_52567| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 370 Score = 31.9 bits (69), Expect = 0.25 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPH 150 P++C C +N+ LK H R +E VC IC+ F+ K + H Sbjct: 259 PHQCTTCGKAFNRSSTLKTHQRTHSTVKE----FVCHICEKGFHQKGNLRNH 306 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFN 142 PYKC C +NK LK H H+ +N C CK F+ Sbjct: 315 PYKCTVCKKAFNKLSNLKFH---SHVHTDNRP-YRCRYCKVAFS 354 >SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 31.9 bits (69), Expect = 0.25 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C + + LK HL + C+ C FN + H R H Sbjct: 133 PYKCDECGKCFTRHAQLKAHL----VIHSGKKPYECDKCGKCFNQSGALTTHLRTH 184 Score = 31.1 bits (67), Expect = 0.44 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C+DC + +KRHLR K+ C+ C + F++ H R H Sbjct: 245 PYECDDCGKRFTLSGNMKRHLRIHSGKKP----YKCDECGNCFSESGQLKVHLRIH 296 Score = 30.3 bits (65), Expect = 0.77 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC++C + + LK HLR H K + + CE+C F K H H Sbjct: 49 PHKCDECGKCFTQSGTLKTHLR-IHTKVKPYE---CEVCGKCFTRKTHLKTHLMVH 100 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKC++C +++ LKRHL Sbjct: 189 PYKCDECGECFSESGKLKRHL 209 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 99 PYKCEDCIVGYNKDVFLKRHLR 120 P+KC+DC Y LK HLR Sbjct: 217 PHKCDDCGKRYTLSGDLKTHLR 238 >SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 31.9 bits (69), Expect = 0.25 Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 5/55 (9%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 P+KC++C +++ K HLR + D CE C+ F D + + +H++ Sbjct: 258 PHKCQECSKAFSR----KSHLRNHILSMHTHDQFECEQCQKFF-DSYNQLHNHQK 307 Score = 31.9 bits (69), Expect = 0.25 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 PYKC +C + L H+R H KR C+IC + F K + H +R Sbjct: 344 PYKCGECGKCFLSISHLSDHVRTVHEKRRRHQ---CKICSTDFLKKCRLLEHIKR 395 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/41 (29%), Positives = 19/41 (46%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKS 139 PYKCE C + + L+ H++ H+ +C C S Sbjct: 170 PYKCEQCSGTFKDNYNLRHHIQSVHLGERPYKCNLCGKCFS 210 >SB_24547| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-18) Length = 195 Score = 31.9 bits (69), Expect = 0.25 Identities = 15/61 (24%), Positives = 25/61 (40%), Gaps = 4/61 (6%) Query: 94 NYLRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 ++++ P+KC DC + K HL ++ C C+ F + V H R Sbjct: 81 DFIKKPFKCVDCGACFR----FKSHLESHAMRHSGEKPFKCAHCERLFRQASTLVRHVRT 136 Query: 154 H 154 H Sbjct: 137 H 137 >SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 31.9 bits (69), Expect = 0.25 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C + + LK HL + C+ C FN + H R H Sbjct: 133 PYKCDECGKCFTRHAQLKAHL----VIHSGKKPYECDKCGKCFNQSGALTTHLRTH 184 Score = 30.3 bits (65), Expect = 0.77 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC++C + + LK HLR H K + + CE+C F K H H Sbjct: 49 PHKCDECGKCFTQSGTLKTHLR-IHTKVKPYE---CEVCGKCFTRKTHLKTHLMVH 100 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C+DC + +KRHLR K+ C+ C + F++ H H Sbjct: 245 PYECDDCGKRFTLSGNMKRHLRIHSGKKP----YKCDECGNCFSESGKLKRHLMIH 296 Score = 28.7 bits (61), Expect = 2.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKC++C + + +LK HL Sbjct: 357 PYKCDECGKSFTEHAYLKTHL 377 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/56 (25%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC++C +++ LK+HL + C++C F + H H Sbjct: 413 PYKCDECGKCFSESGNLKKHL----MIHSGQKPYKCDVCGKCFTRSGALTTHLMIH 464 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKC++C +++ LKRHL Sbjct: 189 PYKCDECGECFSESGKLKRHL 209 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Query: 99 PYKCEDCIVGYNKDVFLKRHLR 120 P+KC+DC Y LK HLR Sbjct: 217 PHKCDDCGKRYTLSGDLKTHLR 238 >SB_11678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 31.5 bits (68), Expect = 0.33 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 Y CE C +NK LK HLR +R CE+C F + H R H Sbjct: 194 YTCEHCGKRFNKSYNLKTHLRVHTGERP----YQCEVCGHGFANLGDLKRHSRTH 244 >SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 31.5 bits (68), Expect = 0.33 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C + L+ H++ H N++ C+ C+ F +S H H Sbjct: 128 PFKCDKCWWSFKNPSGLREHIKAVH----NSEKFKCDYCEKDFKYAKSLKQHIEVH 179 Score = 30.3 bits (65), Expect = 0.77 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIK-----RENADVIVCEICKSTFNDKRSYVPHHR 152 P KC+ C + K L+RH++ H + N + C+ C F +RS H R Sbjct: 214 PEKCDHCGRSFFKPGVLQRHIKTIHSGDKPEWQSNEKLFKCDKCDKDFKTERSVRRHKR 272 >SB_45463| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 347 Score = 31.1 bits (67), Expect = 0.44 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC C +N+ L H+R C+IC F+ K +Y H H Sbjct: 227 PHKCNICGKAFNRSSTLNTHIR----IHAGYKPFQCDICGKGFHQKGNYKNHRLTH 278 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C G+ + L RH + H K + C IC FN + H R H Sbjct: 199 PFKCKICGKGFRQASTLCRH-KIIHTKEKPHK---CNICGKAFNRSSTLNTHIRIH 250 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERH 123 P+ C +C G+ ++ LK+H+R+ H Sbjct: 311 PFTCLECGKGFCRNFDLKKHVRKLH 335 >SB_37102| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 618 Score = 31.1 bits (67), Expect = 0.44 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 Y+C C + + LK H+R +R VCE+C F R+ H R H Sbjct: 424 YRCRLCSKDFTRLSGLKTHIRMHTGERP----YVCEVCSFAFTTSRALKMHMRLH 474 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P++C C++ + + L+RHL + N+ CE C F ++ H H Sbjct: 339 PFRCTQCVMSFTRPSDLQRHL----LIHSNSKPYKCEECDREFTWFGNFQKHILSH 390 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC C + + L+RHL + + C++C +F R+ H +H Sbjct: 507 PFKCTQCPASFIRYGHLQRHL----LIHSDDKPYKCKLCPKSFTQYRNLQTHMYKH 558 >SB_12468| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-30) Length = 824 Score = 31.1 bits (67), Expect = 0.44 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 4/60 (6%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVI----VCEICKSTFNDKRSYVPHHRRH 154 PY+CE C + + L +H+R H+ D CE C F+DK H H Sbjct: 710 PYQCEHCSHAFAQKQNLNKHIRCCHLNIPLRDPFRKPHKCEECGKRFHDKTHLQRHTMIH 769 Score = 29.9 bits (64), Expect = 1.0 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 R P+KCE+C K K HL+ + CE+C F + S H R Sbjct: 744 RKPHKCEEC----GKRFHDKTHLQRHTMIHTGEKPYQCEVCGIPFKELYSLTRHMR 795 >SB_19065| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 531 Score = 31.1 bits (67), Expect = 0.44 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC +C + + LK H+R +R C+ C FN + + H R H Sbjct: 219 PYKCGECEKMFTRFSTLKEHIRTHTGERP----FKCDECGREFNHRSHFNNHLRIH 270 Score = 30.3 bits (65), Expect = 0.77 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Query: 99 PYKCEDCIVGYNKDVFLKRHLR----ERHIKRENAD-VIVCEICKSTFNDKRSYVPHHRR 153 PYKC+ C + + L+ H+R E+ D C+ C+ TF H R Sbjct: 98 PYKCDSCPKQFTRPARLRDHMRTHTGEKPYSVHTGDKPFKCDECEKTFRTALELQAHMGR 157 Query: 154 H 154 H Sbjct: 158 H 158 >SB_56313| Best HMM Match : zf-C2H2 (HMM E-Value=2.3e-14) Length = 910 Score = 30.7 bits (66), Expect = 0.58 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHF 155 + + C+ C + ++ L RH + H R VCE C+ +FN K H ++ + Sbjct: 1 MTFVCDTCSKEFTQETNLVRHKKAIHGNR----AFVCERCQKSFNRKDILKRHEKKTY 54 >SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 717 Score = 30.7 bits (66), Expect = 0.58 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 Y+C++C + K LK HL +K C C TF S H R H Sbjct: 489 YRCDECHSTFTKSTSLKSHL----LKHTGEKKFKCAHCPKTFFSSSSLKIHVRVH 539 >SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 + CE C ++K L+ H+ H K + C +CK F+ S H R H Sbjct: 286 FPCEQCDRSFDKRDRLRIHVLHVHEKHRPHE---CHVCKKRFSQSSSLNKHMRVH 337 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/56 (25%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C + H+R H K + +CE C F H H Sbjct: 370 PFKCKHCGRAFASHAAHDSHVRRTHTKEKPC---ICEYCGKAFAQSYELKFHINMH 422 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 Y CE C + + +RHL+ + CE C +F DKR + H H Sbjct: 254 YSCERCGKVFAYKYYRERHLKYTRCVDQGDRRFPCEQCDRSF-DKRDRLRIHVLH 307 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 PYKC C + L+ H+R+ ++ C+ C F ++ H RR Sbjct: 342 PYKCTYCDKAFTASSILRTHIRQHSGEKP----FKCKHCGRAFASHAAHDSHVRR 392 >SB_54629| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1296 Score = 30.7 bits (66), Expect = 0.58 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 +KC C Y L+ H+R H D C C F +R Y H R H Sbjct: 941 HKCTKCPGSYKSLDALQGHMRRMH-----QDPFECPCCNKVFLKQRQYSHHLRTH 990 >SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41) Length = 1682 Score = 30.7 bits (66), Expect = 0.58 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Query: 5 ENGKSSPNDTDVKVESDSSDLETALPLSQIKEKKRKNAVRGMCAIK--KTKTEMTSDASP 62 +N K++P +T +SD S+ E + S++K++ ++NA R K K K + + S Sbjct: 640 KNKKTTPLNTKYDSKSDESESEESSDDSEVKKRPKRNAKRNQKKGKMAKGKRKRVKEMSE 699 Query: 63 YMDES 67 DE+ Sbjct: 700 SEDEN 704 >SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 211 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KCE C G+ + LK H R ++ C+ C F+ H+R H Sbjct: 3 PFKCEQCGKGFTRAYTLKLHARLHKGEKR----YQCQQCGKCFSKAGYLTVHYRYH 54 >SB_3213| Best HMM Match : zf-C2H2 (HMM E-Value=3.8e-40) Length = 595 Score = 30.3 bits (65), Expect = 0.77 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+CE C + L++H R +R CEIC T+ S H H Sbjct: 518 PYQCESCSKAFTNHSTLRQHRRIHTGERP----YKCEICDRTYRYHSSLKQHLATH 569 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C C+ + LK+H+ +R CE C F + + H R H Sbjct: 490 PYRCPYCLKLFRYSGDLKQHINIHTGQRP----YQCESCSKAFTNHSTLRQHRRIH 541 >SB_2814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 30.3 bits (65), Expect = 0.77 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 7/60 (11%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIK------RENAD-VIVCEICKSTFNDKRSYVPHH 151 P+KC+ C + + L+ HL H RE D + VCE C TF + ++ H Sbjct: 816 PFKCDRCDKAFTQRCSLEAHLTRVHSVVHKYGFRERRDKMFVCEDCGITFKENQAEYRQH 875 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 YKC C ++ L RH++ + C+ C FND H R H Sbjct: 761 YKCGLCNASFSLQRLLNRHMKTHSFYKRYH----CQFCGKGFNDTFDLKRHIRTH 811 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/54 (29%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 Y C+ C G+N LKRH+R C+ C F + S H R Sbjct: 789 YHCQFCGKGFNDTFDLKRHIR----THTGIKPFKCDRCDKAFTQRCSLEAHLTR 838 >SB_44860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 30.3 bits (65), Expect = 0.77 Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C++C + + +LKRHL +++ + C+ C F+ H H Sbjct: 332 PYRCDECGKCFRQSRYLKRHLITHSVQKPHK----CDECGKCFSQSGHLKRHKLIH 383 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 R PYKC++C + + LK HL ++ + C+ C F H R H Sbjct: 78 RKPYKCDECGKCFGRSGTLKIHLLIHKGQKPHK----CDECGKCFTRSGDLKGHLRTH 131 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/53 (24%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 P+KC++C + + L RHL H ++ C+ C + D + ++ H Sbjct: 192 PHKCDECGECFTRSGDLTRHLMS-HSGQKPHQCDQCDKCFTLLGDLKRHLMTH 243 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKC++C + + LK HL Sbjct: 248 PYKCDECGKSFRRSGHLKTHL 268 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 30.3 bits (65), Expect = 0.77 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 + YKC C Y +K+H+R H R + CE+C F + YV H Sbjct: 2594 IEYKCNKCSNSYVSFSEMKKHMRTVHNCRPSK---TCELCSKMF-CRPEYVAKH 2643 Score = 29.5 bits (63), Expect = 1.3 Identities = 9/27 (33%), Positives = 17/27 (62%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERH 123 R P++C+ C + + LKRH+++ H Sbjct: 1929 RTPHQCQFCPYNFPSEAHLKRHIKKTH 1955 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 + YKC C Y +K+H+R H R + CE+C F YV H Sbjct: 2792 IEYKCNKCSNSYVSFSEMKKHMRTVHNCRPSK---TCELCGKKFCTP-EYVAKH 2841 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 + YKC C Y +K+H+ H R + CE+C F + YV H Sbjct: 3514 IEYKCNKCRNSYVSFSEMKKHMSTVHNSRPSK---TCELCSKIF-CRPEYVAKH 3563 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 + YKC C Y +K+H+R H R + CE+C F YV H Sbjct: 3934 IEYKCNKCSNSYVSFSEMKKHMRTVHNCRPSK---TCELCGKMFCTP-EYVAKH 3983 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 4/54 (7%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 + YKC C Y +K+H+ H R + CE+C F + YV H Sbjct: 3724 IEYKCNKCSNSYVSFSEMKKHMSTVHHCRPSK---TCELCSKMF-CRPEYVAKH 3773 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKR 126 P+KC+ C++ + L HL H+K+ Sbjct: 906 PFKCKYCVLQFESKKILVSHLLAIHLKQ 933 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTF 141 LP++C C + + +H+R H R + C +C+ TF Sbjct: 2337 LPFQCTRCRSRFASFGEMSKHMRTLHNTRPSK---TCNLCQKTF 2377 >SB_22835| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 594 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KCE C + L H+R +H+ + + CE C F+ + S+ H H Sbjct: 293 PFKCEMCEQDFPGQTELAEHVR-KHVGEKPFE---CETCGKRFSSQGSFKIHLNSH 344 Score = 29.9 bits (64), Expect = 1.0 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 LP+KC C G+ +RH R R+ C C F K V H RH Sbjct: 211 LPHKCRVCSAGFPTLCKQRRHERSHQKNRQ----FKCNKCSWAFPWKCELVRHQTRH 263 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C+ C + HL+ H + + VCEIC K S H + H Sbjct: 406 PYACDKCPRTFKCRSTRNTHLK-LHTQGVDEKSFVCEICGKGLRTKSSLRDHRKTH 460 Score = 28.7 bits (61), Expect = 2.3 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 7/53 (13%) Query: 102 CEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 C DC G++ + +KRH + + CE+C+ F + H R+H Sbjct: 271 CYDCGRGFSTAIVMKRH-------KFGMNPFKCEMCEQDFPGQTELAEHVRKH 316 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/59 (25%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Query: 96 LRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 L PYKC C ++ RH+ H C+ C TF + + H + H Sbjct: 374 LEKPYKCALCDKAFSHSSHCNRHMETVH---STTRPYACDKCPRTFKCRSTRNTHLKLH 429 >SB_53535| Best HMM Match : zf-C2H2 (HMM E-Value=4.8e-32) Length = 323 Score = 29.9 bits (64), Expect = 1.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Query: 99 PYKCEDCIVGYNKDVFLKRHLR 120 PYKC++C + + LKRH+R Sbjct: 298 PYKCKECSRAFARSTDLKRHMR 319 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC C + + L+RHLR ++ C+ C F H R H Sbjct: 270 PYKCTQCSRAFVRSTDLQRHLRNHTGEKP----YKCKECSRAFARSTDLKRHMRTH 321 >SB_29933| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 420 Score = 29.9 bits (64), Expect = 1.0 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C++C+ +++ LKRHL + C++C F K H H Sbjct: 351 PYECDECVECFSESGNLKRHL----MIHTGQKPYKCDVCGKCFTLKAQLKTHLMIH 402 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C++C +++ LKRHL + + C++C F K H H Sbjct: 174 PYECDECGKCFSESGNLKRHL----MIHKGQKPYKCDVCGKCFTLKEQLKKHLMIH 225 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C+ C +++ V LKRHL + C++C F K H H Sbjct: 295 PYECDKCGKCFSESVNLKRHL----MIDTGQKPYKCDVCGKCFTLKAQLKKHLMIH 346 >SB_21061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 1.0 Identities = 9/25 (36%), Positives = 17/25 (68%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERH 123 P+KC DC + + + + L+RH+ + H Sbjct: 513 PFKCSDCKMSFRQRISLQRHVIKTH 537 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 29.5 bits (63), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 P+ CEDC V + + + L+RHL Sbjct: 230 PFSCEDCGVAFFRKIDLRRHL 250 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKCE C+ + L RH + H+ + C C + F H RRH Sbjct: 581 PYKCEVCMKAFKCSTHLIRH-GKIHVGNK---PFKCNDCDAAFFAAHELKKHSRRH 632 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C G+ LK H+ H ++ C++C F S H R H Sbjct: 665 PHKCDICGKGFVNKGALKLHIVGVHTDKKPHQ---CQLCGKPFLHSCSLEVHMRSH 717 >SB_50303| Best HMM Match : zf-C2H2 (HMM E-Value=1.6e-25) Length = 319 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/56 (28%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C V + LR+ + C IC TF+ S H RRH Sbjct: 42 PYRCP--FVNCRRSFTEHSSLRKHKLTHTGEKPYSCSICGKTFSQSGSRNAHQRRH 95 >SB_49724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/56 (28%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C V + LR+ + C IC TF+ S H RRH Sbjct: 262 PYRCP--FVNCRRSFTEHSSLRKHKLTHTGEKPYSCSICGKTFSQSGSRNAHQRRH 315 >SB_37204| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-25) Length = 455 Score = 29.1 bits (62), Expect = 1.8 Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRE-RHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 ++P+ C+ C + LK H +E ++ K + CE C F ++ + H H Sbjct: 238 KMPFSCKKCYKCFKDAKKLKAHKKEHKNEKSCQRRLFQCETCGKCFMKEKGLLAHMEIH 296 >SB_28304| Best HMM Match : zf-C2H2 (HMM E-Value=2.8026e-45) Length = 243 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC+ C + L +H+R ++ CEIC F+ + H R H Sbjct: 189 PYKCKVCNKAFADSSTLTKHVRTHTGEKPYQ----CEICHQRFSQSGNMNRHKRIH 240 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/56 (23%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P++C C +++ + H+R + +R C++C F D + H R H Sbjct: 161 PFRCRVCGRQFSQSSSVTTHMRTHNGERPYK----CKVCNKAFADSSTLTKHVRTH 212 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/56 (25%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C C+ + + L H R ++ C +C F+ S H R H Sbjct: 133 PYQCMVCLKSFTQAANLTAHFRIHSGEKP----FRCRVCGRQFSQSSSVTTHMRTH 184 >SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 777 Score = 29.1 bits (62), Expect = 1.8 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKS-TFNDKRSYVPHHRR 153 R PYKC++C++ Y K+ + HL H KR++ C C S + N K+ + H RR Sbjct: 494 RKPYKCDECVL-YPKNK-PEEHL-IIHSKRKSYKCDECGKCFSESGNLKKHLIIHSRR 548 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 8/58 (13%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 PYKC+ C G+++ LKRH+ I C+ C F + + H +RH + Sbjct: 606 PYKCDKCGKGFSESGALKRHV----IIHSRRKPYKCDECGKCF----TQLTHVKRHLM 655 Score = 28.7 bits (61), Expect = 2.3 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFND----KRSYVPHHRR 153 PY+C++C Y K LKRHL H +++ C+ C F++ KR + H RR Sbjct: 578 PYQCDECGKCYIKFGALKRHL-SIHTEQK---PYKCDKCGKGFSESGALKRHVIIHSRR 632 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/21 (52%), Positives = 14/21 (66%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKCE+C + + LKRHL Sbjct: 662 PYKCEECGKCFTQLTHLKRHL 682 Score = 27.9 bits (59), Expect = 4.1 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Query: 97 RLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 R PYKC++C + + +KRHL H+ ++ CE C F + + H +RH + Sbjct: 632 RKPYKCDECGKCFTQLTHVKRHLM-IHLGQK---PYKCEECGKCF----TQLTHLKRHLM 683 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKCE+C + ++ LK HL Sbjct: 746 PYKCEECGKCFTQNAHLKTHL 766 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 100 YKCEDCIVGYNKDVFLKRHL 119 YKC++C +N+ LKRHL Sbjct: 469 YKCDECGKCFNRKTNLKRHL 488 >SB_13064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 101 KCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 KC C G+N L+ H+R +++ C+ CK +F+ + H R H Sbjct: 367 KCTLCRRGFNSRSNLRSHMRIHTMEKP----FQCKFCKKSFSQSSTLRNHTRLH 416 >SB_46132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PYKC+ C + KR L +H+ C C S D+ + H R H Sbjct: 679 PYKCDQCTRAFKN----KRQL-TKHMYTHTGKPFTCPTCGSGHYDRLKFNEHMRIH 729 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 + CE C + + RH R+ H + +C IC F S V H R H Sbjct: 763 FSCEKCGKKFAQVASYCRH-RKSH---DGIKDYLCNICNKKFTQSNSLVRHMRSH 813 >SB_52925| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 393 Score = 28.7 bits (61), Expect = 2.3 Identities = 9/21 (42%), Positives = 16/21 (76%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 P+KC++C +N+ +LK+HL Sbjct: 171 PFKCDECGKCFNQQGYLKKHL 191 >SB_50428| Best HMM Match : zf-C2H2 (HMM E-Value=2e-16) Length = 66 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHH 151 PY+CE C +N LK H+R C C TF+ + S++ +H Sbjct: 4 PYQCEYCHQAFNHSSNLKNHMR----LHTGEKPYKCRACDRTFS-RSSHLRNH 51 >SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 615 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTF 141 PY+C+ C Y L+RH+++ H+ E VCE C F Sbjct: 552 PYECQWCPKTYENLEGLRRHIKQ-HVGDEK---FVCEQCDKKF 590 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/54 (25%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 102 CEDCIVGYNKDVFLKRHLRERHIKRE-NADVIVCEICKSTFNDKRSYVPHHRRH 154 C+ C + ++LKRH+ HI +E C+ C T+ + H ++H Sbjct: 525 CDKCHKEFINQIYLKRHM---HIHKEAKKKPYECQWCPKTYENLEGLRRHIKQH 575 >SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 927 Score = 28.7 bits (61), Expect = 2.3 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKS-TFNDKRSYVPHHRR 153 PYKC++C + + LK HL H ++ C C S + N K+ V H RR Sbjct: 214 PYKCDECGKCFTQQTHLKTHLM-IHSGQKPYKCDECGKCFSESGNLKKHLVIHSRR 268 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPH 150 PY C++C + + LKRHLR ++ C+ C F K + H Sbjct: 158 PYNCDECGKCFTQITHLKRHLRIHSGQKP----YKCDECGKCFTRKANLKTH 205 Score = 26.6 bits (56), Expect = 9.5 Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 YKC++C + + LKRHL H +++ + C+ C F + H H Sbjct: 75 YKCDECGKFFTQHAHLKRHLM-THSRQKPYN---CDECGKCFTQQTHLKTHLMIH 125 >SB_52786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 28.7 bits (61), Expect = 2.3 Identities = 14/56 (25%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY C C +K K +++ + A C+ C F+ + + H RRH Sbjct: 300 PYACTYC----DKKFLRKSDMKKHTLMHTGAKPFQCKQCGKVFSQSSNMLTHMRRH 351 >SB_42825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 + C+ C ++ L RH R H + CE C+ +FN K ++ H R++ Sbjct: 197 FVCDICKKEFSLKTNLARHKRSVHGNQS----FQCEKCEKSFNRKDTFKRHMRKY 247 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 120 RERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 +E +R V VC+ICK F+ K + H R Sbjct: 185 KEEEQRRTKIMVFVCDICKKEFSLKTNLARHKR 217 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/28 (32%), Positives = 18/28 (64%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRE 127 ++CE C +N+ KRH+R+ + ++E Sbjct: 225 FQCEKCEKSFNRKDTFKRHMRKYNQEKE 252 >SB_41062| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) Length = 147 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C +C Y LK HL I C C F RS H R H Sbjct: 32 PYQCVECDKFYKHSWHLKTHL----IIHSGQKPYQCNECGKYFRYSRSMKSHQRIH 83 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFIR 157 PY+C +C Y LK HL I + C+ C F R+ HR ++ Sbjct: 88 PYQCVECDKFYKHSWHLKTHL----IIHSGQEPYQCDECGKCFRYSRTPNGTHRAEIVQ 142 >SB_6685| Best HMM Match : zf-C2H2 (HMM E-Value=2.4e-31) Length = 147 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C +C Y LK HL I C C F RS H R H Sbjct: 32 PYQCVECDKFYKHSWHLKTHL----IIHSGQKPYQCNECGKYFRYSRSMKSHQRIH 83 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFIR 157 PY+C +C Y LK HL I + C+ C F R+ HR ++ Sbjct: 88 PYQCVECDKFYKHSWHLKTHL----IIHSGQEPYQCDECGKCFRYSRTPNGTHRAEIVQ 142 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/54 (24%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 PY C+ ++G NK L + H+ + C C T+ + H R Sbjct: 923 PYVCQ--VIGCNKRFTEYSSLYKHHVVHTHTKPYTCNACNKTYRQTSTLANHKR 974 >SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) Length = 477 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFIR 157 PYKC C + L+ H+R+ ++ C+ C F ++ H RR R Sbjct: 331 PYKCTFCDKAFTASSILRTHIRQHSGEKP----FKCKYCGRAFASHAAHDSHVRRTHTR 385 >SB_53497| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 462 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKC +C + Y K L RHL Sbjct: 255 PYKCNECDMCYAKSGALSRHL 275 >SB_51466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Query: 13 DTDVKVESDSSDLETALPLSQIKEKKRKNAVRG 45 D D+ E+D S+ E P SQ++ +K ++ + G Sbjct: 45 DDDIDDEADDSEEERGTPTSQVRSRKPRSFLTG 77 >SB_15832| Best HMM Match : zf-C2H2 (HMM E-Value=7e-35) Length = 337 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Query: 103 EDCIVGYNKDVFLKRHLRERHIKRENADVIV----CEICKSTFNDKRSYVPHHRRH 154 +DC + ++ L +H+ HIK+E D C + F + V H RRH Sbjct: 24 KDCTIVFDSQDSLVKHVNGDHIKKEKRDFTCYWQDCSREQRPFKAQYMLVVHMRRH 79 >SB_9370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/37 (32%), Positives = 18/37 (48%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEI 136 +KC +C Y LKRH H +R+ +V E+ Sbjct: 59 HKCTECDKTYMHHYHLKRHFLSVHSRRKRGEVEYTEV 95 >SB_14469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 99 PYKCEDCIVGYNKDVFLKRHL 119 PYKC++C + K + LK+HL Sbjct: 84 PYKCDECGKCFAKSLKLKKHL 104 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPH 150 P+KC+ C + + LK H+R + + C C FN K + H Sbjct: 552 PHKCKKCGRAFKQLTHLKYHMR----THSDVRMYKCPYCDKGFNQKSNLQAH 599 >SB_49805| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-12) Length = 74 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 PY+C C+ ++ LK H + H + + CE C FN H R+H Sbjct: 18 PYQCCQCVKCFSTLYKLKSH-KSIHTGEKPYE---CEQCGKRFNQSAGLRCHQRKH 69 >SB_389| Best HMM Match : zf-C2H2 (HMM E-Value=1.8e-29) Length = 383 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C + + V L+ H R A C+ C +F+ H+R H Sbjct: 318 PFKCQHCSKSFTQAVTLRSHTR----THTGAKPYNCKRCSKSFSCFSGLRGHNRIH 369 >SB_40645| Best HMM Match : zf-C2H2 (HMM E-Value=3.30006e-42) Length = 554 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Query: 98 LPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 LP KC C +++ L+ H+R ++ C CK F D+ + H + H + Sbjct: 469 LPCKCSICGKAFSRPWLLQGHIRTHTGEKP----YQCTNCKRAFADRSNLRAHMQTHAV 523 >SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1239 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/54 (22%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 102 CEDCIVGYNKDVF-LKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 CE+C + + + + + E+ + + + C+ C F DKR+ H H Sbjct: 405 CEECKRNFAESLNRINQQFLEKTLLSKTVKIFTCDHCGVNFLDKRTLNKHRLNH 458 >SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 27.5 bits (58), Expect = 5.4 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Query: 102 CEDCIVGYNKDVFLKRHLRERHIKRENADVIV-CEICKSTFNDKRSYVPHHRRH 154 C C + +FL + H KR A V C +C+ +F KRS H H Sbjct: 254 CSYCNKKFTSKIFL-----DAHTKRHEAMVPYNCSLCEKSFAKKRSLKSHMYSH 302 >SB_49827| Best HMM Match : zf-C2H2 (HMM E-Value=7e-07) Length = 279 Score = 27.5 bits (58), Expect = 5.4 Identities = 18/56 (32%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P C C + +LK HLR H K C C FN + H RRH Sbjct: 227 PVWCSVCRKKLRRKQYLKAHLRI-HTKEMPYR---CRFCSKAFNQVGNCRVHERRH 278 >SB_48551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 560 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 PYKC C + L+ H+R+ ++ C+ C F ++ H RR Sbjct: 408 PYKCPYCEKAFTASSILRTHVRQHSGEKP----FKCKHCGKAFASHAAHDSHVRR 458 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/56 (25%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P+KC+ C + H+R H K + VC C F H H Sbjct: 436 PFKCKHCGKAFASHAAHDSHVRRTHTKEKPC---VCHFCGKAFAQSYELKFHINMH 488 >SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query: 1 MVDFENGKSSPNDTDVKVESDSSDLETALP--LSQIKEKK 38 ++D + +P TD K+ S DL+ LP ++QI +KK Sbjct: 152 ILDQSSSAETPGQTDKKMAPASRDLQAKLPAEVAQIPKKK 191 >SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) Length = 351 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Query: 1 MVDFENGKSSPNDTDVKVESDSSDLETALP--LSQIKEKK 38 ++D + +P TD K+ S DL+ LP ++QI +KK Sbjct: 152 ILDQSSSAETPGQTDKKMAPASRDLQAKLPAEVAQIPKKK 191 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/43 (30%), Positives = 21/43 (48%) Query: 114 FLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 F + L E + E +VC +CKS F + VP + +F+ Sbjct: 154 FCRHCLEELAVHSEGKGKLVCPLCKSEFQISPADVPSLKVNFM 196 >SB_53672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/57 (28%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRHFI 156 Y CE C Y + LK H+R + C+ C+ F D + H R H + Sbjct: 542 YLCELCGKLYTRKYGLKIHMRIH----TGYKPLKCKYCQKRFGDPSNMAKHIRLHAV 594 >SB_44864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 P++C+ C + + LKRHL K D C C + D R + H R Sbjct: 252 PHRCDQCGKRFTRSESLKRHLITYSQKPHQCD--QCGKCFTLLGDLRRHQFIHSR 304 >SB_43891| Best HMM Match : zf-C2H2 (HMM E-Value=3e-30) Length = 130 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 P++C+ C + + LKRHL K D C C + D R + H R Sbjct: 60 PHRCDQCGKRFTRSESLKRHLITYSQKPHQCD--QCGKCFTLLGDLRRHQFIHSR 112 >SB_29493| Best HMM Match : PH (HMM E-Value=0.48) Length = 1064 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/35 (31%), Positives = 22/35 (62%) Query: 10 SPNDTDVKVESDSSDLETALPLSQIKEKKRKNAVR 44 SP+ + ++ ++ SD+ T P+ +KKRKN ++ Sbjct: 135 SPSSSKNRILAEQSDVVTTPPIMTGTKKKRKNGLK 169 >SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) Length = 436 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/39 (30%), Positives = 23/39 (58%) Query: 6 NGKSSPNDTDVKVESDSSDLETALPLSQIKEKKRKNAVR 44 NG S +T++++E D D E +L + +IK + ++ R Sbjct: 119 NGSSLKEETELQLELDKLDRERSLHIREIKRLQHEDNSR 157 >SB_22532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/59 (25%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Query: 95 YLRLPYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRR 153 YL Y+C C Y+ RH+ + H+ C +C S+F H R Sbjct: 467 YLEKHYRCMKCFSVYSSRNNFLRHVSKAHL---YDTYYQCHMCGSSFTSMEDLTQHTLR 522 >SB_48462| Best HMM Match : zf-C2H2 (HMM E-Value=1.1e-18) Length = 536 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 100 YKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 Y+C C + ++HL +HI N ++I C C F+ + H H Sbjct: 104 YRCNFCFKTFKCVNVYRQHLASQHI---NEEIICCVNCHVRFDSLVALRRHQDTH 155 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 9 SSPNDTDVKVESDSSDLETALPLSQIKEKKRKNAVRGMCAIKKTKTEMTSDAS 61 S ND ES+ DL+T ++ +K ++ A + K ++ ++AS Sbjct: 2806 SKANDYSYTFESEKEDLKTEASVASVKSREPSKANDYSYTFESEKEDLKTEAS 2858 >SB_21766| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-15) Length = 281 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/36 (33%), Positives = 15/36 (41%) Query: 119 LRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 LR+ + C IC TF+ S H RRH Sbjct: 22 LRKHKLTHTGEKPYSCSICGKTFSQSGSRNAHQRRH 57 >SB_17982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 474 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/56 (25%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRSYVPHHRRH 154 P++C C + K L H+R +R VC C F + H + H Sbjct: 380 PHQCHLCEKAFTKPATLVDHIRTHSSERP----YVCSECNKGFTHPSNLTSHMKTH 431 >SB_10756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 713 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICK 138 PY C C +N+ L H+R N VC+ CK Sbjct: 676 PYVCPQCNKAFNRASNLHTHMR----THTNYKPFVCDFCK 711 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/46 (30%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Query: 99 PYKCEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDK 144 PYKC+ C Y + L+ H I C+ C FN K Sbjct: 1291 PYKCDMCDKSYKRPDALRVH----KISHSEDKPFKCDTCGRKFNQK 1332 >SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1604 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 125 KRENADVIVCEICKSTFNDKRSY 147 KR+N + +CK+++ND SY Sbjct: 1076 KRDNEESYTLVVCKASYNDSGSY 1098 >SB_27714| Best HMM Match : AA_permease (HMM E-Value=0.29) Length = 420 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/18 (61%), Positives = 14/18 (77%) Query: 5 ENGKSSPNDTDVKVESDS 22 ENGKS ++TDVKV D+ Sbjct: 134 ENGKSHRSNTDVKVHGDA 151 >SB_26290| Best HMM Match : zf-C2H2 (HMM E-Value=5.5e-08) Length = 317 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/45 (24%), Positives = 20/45 (44%) Query: 102 CEDCIVGYNKDVFLKRHLRERHIKRENADVIVCEICKSTFNDKRS 146 C C+ + F + +RHI +++A + C C T K + Sbjct: 250 CHPCVCNECNETFDHENKLKRHINKKHAASLKCGDCGKTLQRKET 294 >SB_17045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 26.6 bits (56), Expect = 9.5 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Query: 3 DFENGKSSPNDTDVKVESDSSDLETALPLSQIKEKKRKNAVRGMCAIKKTKTEMTSDAS 61 + E S+ + D S ++ TA+ + K +RK AV GM K+ E SD S Sbjct: 162 EMERNGSASQENDSGDGSTDDEVNTAMQKN--KRPRRKAAVGGMKKRKRVMIESDSDGS 218 >SB_4758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 120 RERHIKRENADVIVCEICKSTFNDKRSYVPHHR 152 +E +R V +C+ICK F+ K + H R Sbjct: 483 KEEEQRRTRIMVFLCDICKKEFSLKTNLARHKR 515 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.133 0.391 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,072,583 Number of Sequences: 59808 Number of extensions: 178899 Number of successful extensions: 1282 Number of sequences better than 10.0: 123 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 55 Number of HSP's that attempted gapping in prelim test: 748 Number of HSP's gapped (non-prelim): 503 length of query: 157 length of database: 16,821,457 effective HSP length: 76 effective length of query: 81 effective length of database: 12,276,049 effective search space: 994359969 effective search space used: 994359969 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -