BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001655-TA|BGIBMGA001655-PA|IPR001683|Phox-like (272 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0374 - 2843405-2843508,2844134-2844239,2844327-2844409,284... 48 1e-05 05_07_0267 + 28818396-28818513,28819292-28819697,28819796-288199... 44 2e-04 01_06_1430 - 37309737-37309946,37310049-37310100,37310348-373104... 37 0.015 01_05_0293 - 20532559-20532572,20532573-20532798,20532926-205339... 33 0.32 12_01_1012 + 10298548-10298731,10299141-10299211,10299289-102993... 31 1.3 04_03_0439 + 15937934-15938167,15938276-15938476,15938852-159389... 30 2.3 02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-57... 29 4.0 09_04_0613 + 18953761-18953932,18954672-18954799,18954885-189549... 28 7.0 >11_01_0374 - 2843405-2843508,2844134-2844239,2844327-2844409, 2844886-2845078,2845527-2845662,2846185-2846264, 2846348-2846932,2847058-2847126,2847203-2847347, 2847442-2847542,2848208-2849066,2849397-2849536, 2849606-2849783,2849885-2850287,2850770-2850833, 2851223-2851278,2851470-2851572 Length = 1134 Score = 47.6 bits (108), Expect = 1e-05 Identities = 30/98 (30%), Positives = 55/98 (56%), Gaps = 6/98 (6%) Query: 99 KLQIPIVG--YEVMEERARFTIYKLKVEDDKRDQSWLVFRRYTDFVRLYTRLKSEQPNIE 156 K++ +VG +E + ++ F +Y + V D + +++W V RRY +F RL+ +LK E PN Sbjct: 597 KIRCRVVGAYFEKLSSKS-FAVYSIAVTDAE-NKAWFVKRRYRNFERLHRQLK-EIPNYS 653 Query: 157 LPLPGKRWFRDNFEPTFLEERVRGLQTFVNVILYKLPN 194 L LP K + + + + +R L ++ +L +PN Sbjct: 654 LHLPPKSFLSSSIDDYLVHQRCILLDKYLQELL-SIPN 690 >05_07_0267 + 28818396-28818513,28819292-28819697,28819796-28819973, 28820414-28820553,28820629-28821874,28821952-28822052, 28822170-28822314,28822755-28822823,28822910-28822955, 28823049-28823422,28823622-28823701,28823813-28823948, 28824199-28824358,28824582-28824664,28825417-28825545 Length = 1136 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 3/92 (3%) Query: 99 KLQIPIVGYEVMEERA-RFTIYKLKVEDDKRDQSWLVFRRYTDFVRLYTRLKSEQPNIEL 157 KL+ +VG +++ + F +Y + V D SW + RR+ F L+ RLK E L Sbjct: 692 KLKCEVVGASIVKSGSGMFAVYSVSVTD-ANGNSWSIKRRFRHFEELHRRLK-EYSQYNL 749 Query: 158 PLPGKRWFRDNFEPTFLEERVRGLQTFVNVIL 189 LP K + E + ER + L ++ +L Sbjct: 750 HLPPKHFLSSGLEVPVVRERCKLLDIYLKKLL 781 >01_06_1430 - 37309737-37309946,37310049-37310100,37310348-37310427, 37310538-37310606,37310710-37310843,37311173-37311332, 37311483-37311554,37312113-37312246,37312386-37312521, 37313273-37313416 Length = 396 Score = 37.1 bits (82), Expect = 0.015 Identities = 30/89 (33%), Positives = 42/89 (47%), Gaps = 4/89 (4%) Query: 126 DKRDQSWLVFRRYTDFVRLYTRLKSEQPNIEL-PLPGKRWF-RDNFEPTFLEERVRGLQT 183 D Q +V RRY+DF L+ RL + I + PLP K + F F+E R + L Sbjct: 53 DFEGQEKIVIRRYSDFEWLHDRLAEKYKGIFIPPLPEKNAVEKFRFSKEFIELRRQALDL 112 Query: 184 FVNVILY--KLPNNPIVREFFCLDEPPQD 210 FVN I +L + ++ F DE D Sbjct: 113 FVNRIASHPELKQSGDLKIFLQADEEKMD 141 >01_05_0293 - 20532559-20532572,20532573-20532798,20532926-20533960, 20534670-20534996 Length = 533 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Query: 116 FTIYKLKVEDDKRDQSWLVFRRYTDFVRLYTRLK 149 +T+Y LKV+ + D W + RRY +F LY +LK Sbjct: 210 YTVYLLKVKSGEDD--WEIERRYREFYALYQQLK 241 >12_01_1012 + 10298548-10298731,10299141-10299211,10299289-10299349, 10299689-10299747 Length = 124 Score = 30.7 bits (66), Expect = 1.3 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Query: 13 DAMNNDVSSASSEDNTTFGKIRRYYKNRRDSTSDS-EMP--VRPQRMHKSMHNLH 64 D +NN+ S +ED TF ++ Y N + + ++P VR + + SMHN++ Sbjct: 9 DYINNNKDS--TEDEVTFAQVEMVYDNEKTGYAQMLQLPRDVRSSQSNSSMHNIY 61 >04_03_0439 + 15937934-15938167,15938276-15938476,15938852-15938911, 15939896-15939958,15940822-15940848,15941020-15941358 Length = 307 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Query: 36 YYKNRRDSTSDSEMPVRPQRMHKSMHNLHENQRNDY 71 YY++R D E+ + +M S +LH+N RN Y Sbjct: 131 YYQHRVDKKVPIEVTIIHNQMRGSGESLHDNDRNKY 166 >02_01_0084 - 573638-574305,574705-574900,574997-577246,578053-579174, 579266-579370,579975-580028,580244-580344,580454-581423, 582030-582203,582341-582643,582719-582856,582993-583247, 584230-584370,585008-585289,585395-585540,585627-585690, 585723-585799,586285-586301,587728-587867,587972-588029, 588121-588218,588727-588776,589260-589743 Length = 2630 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 32 KIRRYYKNRRDSTSDSEMPVRPQRMHKSMHNL 63 +++R Y+NRR + S +PV + HK+ L Sbjct: 450 ELKRKYENRRKAAKQSSIPVETKVKHKTFQKL 481 >09_04_0613 + 18953761-18953932,18954672-18954799,18954885-18954956, 18955033-18955146,18955547-18955615,18955691-18955747, 18956262-18956315,18956387-18956449,18956543-18956605, 18956803-18956967,18957111-18957266,18957315-18957416 Length = 404 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Query: 216 EVQAVYGALEDSITSLRMQLKQKDATIMHLQK 247 +++A ALE SIT +LK KD I L+K Sbjct: 49 QLRAKISALESSITKQTQELKSKDDGIQKLEK 80 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.320 0.135 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,185,703 Number of Sequences: 37544 Number of extensions: 279842 Number of successful extensions: 601 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 597 Number of HSP's gapped (non-prelim): 8 length of query: 272 length of database: 14,793,348 effective HSP length: 81 effective length of query: 191 effective length of database: 11,752,284 effective search space: 2244686244 effective search space used: 2244686244 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -