BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001655-TA|BGIBMGA001655-PA|IPR001683|Phox-like (272 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.9 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 8.9 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.9 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Query: 17 NDVSSASSEDNTTFGKIRR-YYKNRRDSTSDSEMPVRPQRMH 57 N SS T GK + YY + DSE + P+R H Sbjct: 369 NRYSSGRVLMRTVRGKEKTCYYPYHPSTQEDSEEHLTPKRFH 410 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 8.9 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Query: 17 NDVSSASSEDNTTFGKIRR-YYKNRRDSTSDSEMPVRPQRMH 57 N SS T GK + YY + DSE + P+R H Sbjct: 369 NRYSSGRVLMRTVRGKEKTCYYPYHPSTQEDSEEHLTPKRFH 410 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.135 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,572 Number of Sequences: 429 Number of extensions: 3383 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 272 length of database: 140,377 effective HSP length: 57 effective length of query: 215 effective length of database: 115,924 effective search space: 24923660 effective search space used: 24923660 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -