BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001654-TA|BGIBMGA001654-PA|IPR007087|Zinc finger, C2H2-type (261 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.1 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.4 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 7.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.1 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 21 9.4 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 4.1 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 8/48 (16%) Query: 181 TPEKKHNKRE---TTDNAQCTD-----SKTSTIDTKAEDHREVNIKNE 220 TP +KRE T+D AQ D K + + E+H V IK E Sbjct: 840 TPRSTPDKREKSPTSDKAQEADGEVVVKKEVDEEERLENHTSVKIKRE 887 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 203 STIDTKAEDHRE 214 S ID KAE+H+E Sbjct: 176 SVIDEKAEEHKE 187 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 7.1 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 168 NIVIVASLKPKLYTPEKKHNKRETTDNA-QCTD 199 NI I+ L L +KH K+E+ D + TD Sbjct: 5 NITILLLLTIGLAAAARKHQKQESRDEEYEATD 37 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 9 ESWAITGERLDSKYEKCLNI 28 E W G LD +Y KC + Sbjct: 1508 EKWNFDGLDLDWEYPKCWQV 1527 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Query: 9 ESWAITGERLDSKYEKCLNI 28 E W G LD +Y KC + Sbjct: 2431 EEWNFDGLDLDWEYPKCWQV 2450 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 206 DTKAEDHREVNIKNEN 221 D K+ED +++KNEN Sbjct: 214 DGKSEDVPVISLKNEN 229 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.309 0.123 0.341 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,721 Number of Sequences: 317 Number of extensions: 1513 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 261 length of database: 114,650 effective HSP length: 56 effective length of query: 205 effective length of database: 96,898 effective search space: 19864090 effective search space used: 19864090 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -