SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001654-TA|BGIBMGA001654-PA|IPR007087|Zinc finger,
C2H2-type
         (261 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    24   5.1  

>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 12/39 (30%), Positives = 19/39 (48%)

Query: 151  SIKANQVDSPHNVMGVPNIVIVASLKPKLYTPEKKHNKR 189
            S + N+V+      G+P   + A+ +  LY    KHN R
Sbjct: 1559 SDEENEVEKDKEKEGMPGSSVTAAKERCLYEAVLKHNHR 1597


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.309    0.123    0.341 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 198,930
Number of Sequences: 2123
Number of extensions: 6059
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 261
length of database: 516,269
effective HSP length: 63
effective length of query: 198
effective length of database: 382,520
effective search space: 75738960
effective search space used: 75738960
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.7 bits)
S2: 47 (23.0 bits)

- SilkBase 1999-2023 -