BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001651-TA|BGIBMGA001651-PA|IPR001484|Pyrokinin, IPR000437|Prokaryotic membrane lipoprotein lipid attachment site, IPR008730|Pheromone biosynthesis activating neuropeptide (187 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66430.1 68414.m07546 pfkB-type carbohydrate kinase family pr... 31 0.36 At2g29510.1 68415.m03584 expressed protein 31 0.48 At5g09770.1 68418.m01131 ribosomal protein L17 family protein co... 29 1.9 At3g42990.1 68416.m04515 hypothetical protein 29 1.9 At5g36020.1 68418.m04339 hypothetical protein similar to At5g281... 29 2.6 At2g15900.1 68415.m01822 phox (PX) domain-containing protein wea... 29 2.6 At4g29740.2 68417.m04236 FAD-binding domain-containing protein /... 28 3.4 At4g29740.1 68417.m04235 FAD-binding domain-containing protein /... 28 3.4 At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative... 27 5.9 At3g06290.1 68416.m00722 SAC3/GANP family protein contains Pfam ... 27 5.9 At5g61780.1 68418.m07753 tudor domain-containing protein / nucle... 27 7.8 At3g62030.1 68416.m06967 peptidyl-prolyl cis-trans isomerase, ch... 27 7.8 >At1g66430.1 68414.m07546 pfkB-type carbohydrate kinase family protein contains Pfam profile: PF00294 pfkB family carbohydrate kinase Length = 384 Score = 31.5 bits (68), Expect = 0.36 Identities = 19/87 (21%), Positives = 39/87 (44%), Gaps = 1/87 (1%) Query: 17 SIFFASCTDMKDESDRGAHSERGALWFGPRLGKRSMKPSTEDNRQTFLRLLEAADALKFY 76 S+ C + + A L + P L + + PS ++ R+ L + E AD +K Sbjct: 199 SLITEPCKSAHISAAKAAKEAGVILSYDPNL-RLPLWPSADNAREEILSIWETADIIKIS 257 Query: 77 YDQLPYERQADEPETKVTKKIIFTPKL 103 +++ + + ++P + +F PKL Sbjct: 258 EEEIVFLTKGEDPYDDNVVRKLFHPKL 284 >At2g29510.1 68415.m03584 expressed protein Length = 839 Score = 31.1 bits (67), Expect = 0.48 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 6/109 (5%) Query: 57 EDNRQTFLRLLEAADALKFYYDQLPYERQADEPETKVTKKIIFTPKLGRSVAKPQTHESL 116 E NR+ F L D P+ R+AD K+I F + RS + P++ ++ Sbjct: 315 ESNRKGFTERLAHGKTAVLDSDVGPFRREADGGSKPFLKRISFLSE--RSCSAPRSRKA- 371 Query: 117 EFIPRLGRRLSEDMPATPADQEMYQPDPEEMESRTRYFSPRLGRTMSFS 165 E P R L T Q +P + + R R SP R +SFS Sbjct: 372 ESSPSRSRTLDRRSTETLPKQSDQKP-AKVLSERARSISP--FRRLSFS 417 >At5g09770.1 68418.m01131 ribosomal protein L17 family protein contains Pfam profile: PF01196 ribosomal protein L17 Length = 160 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 116 LEFIPRLGRRLSEDMPATPADQEMYQPDPEEMESRTRYFSP 156 +EFI R L + PATP + DP E TR F+P Sbjct: 110 IEFIDR-ENELRQSKPATPQPPQRVPLDPWERSRLTRQFAP 149 >At3g42990.1 68416.m04515 hypothetical protein Length = 129 Score = 29.1 bits (62), Expect = 1.9 Identities = 18/93 (19%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Query: 65 RLLEAADALKFYYDQLPYERQADEPETKVTKKIIFTPKLGRSVAKPQTHESLEFIPRLGR 124 R+L A D K+ +++ +A T T ++IF P+ + + H + G+ Sbjct: 36 RVLRADD--KYLGNRIKESSRARLENTSETLRVIFRPEFSSASGTSRYHPEANLVNASGK 93 Query: 125 RLSEDMPATPADQEMYQPDPEEMESRTRYFSPR 157 R + + P EE + ++ +P+ Sbjct: 94 RSNSHKTSRLTTNRQEVPGSEENSLKPKHLNPK 126 >At5g36020.1 68418.m04339 hypothetical protein similar to At5g28170, At1g35110, At1g44880, At3g42530, At4g19320, At4g03970, At3g43010, At2g10350 Length = 721 Score = 28.7 bits (61), Expect = 2.6 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 5/97 (5%) Query: 47 LGKRSMKPSTEDNRQTFLRLLEAADALKFYYDQLPYERQADEPETKVTKKIIFTPKLGRS 106 L ++ P +DN LE +A + P E D+ T+VT + T S Sbjct: 591 LSQKEQSPLEQDNIME--ETLETVEASHSVLETQPEENIDDDHMTEVTLESAAT---SHS 645 Query: 107 VAKPQTHESLEFIPRLGRRLSEDMPATPADQEMYQPD 143 V PQ + +E + +++ +MPA+ QP+ Sbjct: 646 VELPQPDDPMELHVYINIQVTLEMPASSHSVSEAQPE 682 >At2g15900.1 68415.m01822 phox (PX) domain-containing protein weak similarity to SP|Q9Y5W8 Sorting nexin 13 {Homo sapiens}; contains Pfam profiles PF00787: PX domain, PF02194: PXA domain Length = 1009 Score = 28.7 bits (61), Expect = 2.6 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Query: 18 IFFASCTDMKDESDRGAHSERGALWFGPRLGKRSMKPST-EDNRQTFLRLLEAADALKFY 76 +FF D ++ SD SE+ G G + KPS+ E + F R A++ KF Sbjct: 884 VFFTRLNDSQEASDETDPSEKTYQMAGQLGGMKVTKPSSFEQQLEAFRR---ASEIKKFL 940 Query: 77 YDQLP 81 +D P Sbjct: 941 FDGAP 945 >At4g29740.2 68417.m04236 FAD-binding domain-containing protein / cytokinin oxidase family protein similar to cytokinin oxidase, Zea mays [gi:3882018] [gi:3441978] Length = 524 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 159 GRTMSFSPRLGRELSYGMFNVLGTFAV 185 G M+ SP+L EL YG+ LG F + Sbjct: 212 GEMMTCSPKLNPELFYGVLGGLGQFGI 238 >At4g29740.1 68417.m04235 FAD-binding domain-containing protein / cytokinin oxidase family protein similar to cytokinin oxidase, Zea mays [gi:3882018] [gi:3441978] Length = 428 Score = 28.3 bits (60), Expect = 3.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Query: 159 GRTMSFSPRLGRELSYGMFNVLGTFAV 185 G M+ SP+L EL YG+ LG F + Sbjct: 212 GEMMTCSPKLNPELFYGVLGGLGQFGI 238 >At5g09350.1 68418.m01083 phosphatidylinositol 4-kinase, putative strong similarity to gi:4467359 Length = 1116 Score = 27.5 bits (58), Expect = 5.9 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Query: 81 PYERQADEPET---KVTKKIIFTP-KLGRSVAKPQTHESLEFIPRLGRRLSEDMPATPAD 136 P R +EP T KV K + + KL P T +SL F P G L +D AD Sbjct: 152 PLMRPHNEPSTPGSKVLNKFLSSKQKLFSLTLSPPTQKSLLFSPTSGSNLQDDGSQLSAD 211 >At3g06290.1 68416.m00722 SAC3/GANP family protein contains Pfam profile: PF03399 SAC3/GANP family Length = 1720 Score = 27.5 bits (58), Expect = 5.9 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 4/40 (10%) Query: 50 RSMKPSTEDNRQTFLRLLEAADALKFYYDQLPYERQADEP 89 ++MKP DN+QTF L + DALK D LP +++P Sbjct: 443 KTMKPL--DNKQTFNSLESSRDALK--GDALPDYENSEQP 478 >At5g61780.1 68418.m07753 tudor domain-containing protein / nuclease family protein contains Pfam domains PF00567: Tudor domain and PF00565: Staphylococcal nuclease homologue Length = 985 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 80 LPYERQADEPETKVTKKIIFTPKLGR--SVAKPQTHESLEFIPRL 122 L + R PE +T + PK+ R + +P ES EF+ +L Sbjct: 30 LTHNRAGPPPEKTITLSSLMAPKMARRGGIDEPFAWESREFLRKL 74 >At3g62030.1 68416.m06967 peptidyl-prolyl cis-trans isomerase, chloroplast / cyclophilin / rotamase / cyclosporin A-binding protein (ROC4) identical to peptidyl-prolyl cis-trans isomerase, chloroplast precursor, PPIase (cyclophilin, cyclosporin A-binding protein) [Arabidopsis thaliana] SWISS-PROT:P34791; identical to cDNA nuclear-encoded chloroplast stromal cyclophilin (ROC4) GI:405130 Length = 260 Score = 27.1 bits (57), Expect = 7.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Query: 83 ERQADEPETKVTKKIIFTPKLGRSVA 108 E + EP+ KVT K+ F ++G VA Sbjct: 83 EEEVIEPQAKVTNKVYFDVEIGGEVA 108 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,421,025 Number of Sequences: 28952 Number of extensions: 181411 Number of successful extensions: 401 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 7 Number of HSP's that attempted gapping in prelim test: 396 Number of HSP's gapped (non-prelim): 13 length of query: 187 length of database: 12,070,560 effective HSP length: 77 effective length of query: 110 effective length of database: 9,841,256 effective search space: 1082538160 effective search space used: 1082538160 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -